DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Cp1

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_523735.2 Gene:Cp1 / 36546 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster


Alignment Length:350 Identity:139/350 - (39%)
Similarity:196/350 - (56%) Gaps:27/350 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDE-ERVYRESIFAAKMSLITLSNKNADNG 78
            |.||..:::.|..||..:. ::.:..|..:..|.|.|| |..:|..||......|...|:....|
  Fly    37 LPLLALLAVAQAVSFADVV-MEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEG 100

  Fly    79 VSGFRLGVNTLADMTRKEIATLLGSKISEFGERYT--------NGHINFVTARNPASANLPEMFD 135
            ...|:|.||..||:...|...|:.      |..||        :.....||..:||...||:..|
  Fly   101 KVSFKLAVNKYADLLHHEFRQLMN------GFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVD 159

  Fly   136 WREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQ 200
            ||.||.||....|| .||:||:|::||||||..||::|||.|||:||||||:..|||.||:||..
  Fly   160 WRTKGAVTAVKDQG-HCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLM 223

  Fly   201 EYGFEYIRDH-GVTLANKYPYTQTEMQCRQNE-TAGRPPRESLVKIRDYATITPGDEEKMKEVIA 263
            :..|.||:|: |:.....|||...:..|..|: |.|...       |.:..|..|||:||.|.:|
  Fly   224 DNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATD-------RGFTDIPQGDEKKMAEAVA 281

  Fly   264 TLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGT-ENGRDYWIIKNSYSQNWGE 327
            |:||::.:::|...||:.||.|:|.:.:|:...|:|.|.|||:|| |:|.|||::|||:...||:
  Fly   282 TVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGD 346

  Fly   328 GGFMRILRNAGGFCGIASECSYPIL 352
            .||:::|||....|||||..|||::
  Fly   347 KGFIKMLRNKENQCGIASASSYPLV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/59 (31%)
Peptidase_C1A 131..350 CDD:239068 103/221 (47%)
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 18/58 (31%)
Peptidase_C1 154..370 CDD:278538 105/223 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.