DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CG6337

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster


Alignment Length:336 Identity:91/336 - (27%)
Similarity:138/336 - (41%) Gaps:41/336 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKE 96
            |.|.|.::|...:|  ..|...|.:....|....:.:...|..||...:.:|..||..:|:...:
  Fly    25 LVDFQTYEDNFNKT--YASTSARNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQ 87

  Fly    97 IATLLGSKISEFGERYTNGHINFVTAR---NPASANLPEMFDWREKGGVT-PPGFQGVGCGACWS 157
            .|.||...            :|.||:.   .|||......||.....|:| ....|||.|.:.|:
  Fly    88 FAALLPKA------------VNTVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWA 140

  Fly   158 FATTGALE--GHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTLANKYPY 220
            :||..|:|  ..:.....:.:|||.|.|:|||.  ...||..........|:..  :|.|..|| 
  Fly   141 YATAKAVEIMNAVQTANPLPSSLSAQQLLDCAG--MGTGCSTQTPLAALNYLTQ--LTDAYLYP- 200

  Fly   221 TQTEMQCRQNETAGRP----PRESL---VKIRDYATITPGDEEKMKEVIATLGPLACSMNADTIS 278
               |:....|.:...|    |..|:   ||:..|:|:...|:..:...::...|:....|..|..
  Fly   201 ---EVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPATFG 262

  Fly   279 FEQYSGGIY--EDEECNQGELNHSVTVVGY--GTENGRDYWIIKNSYSQNWGEGGFMRILRNAGG 339
            |.|||.|:|  |.......:.:..:.||||  ..::..|||...||:...|||.|::||:|.:..
  Fly   263 FMQYSSGVYVQETRALTNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ 327

  Fly   340 FCGIASECSYP 350
              .||....:|
  Fly   328 --PIAKNAVFP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 12/58 (21%)
Peptidase_C1A 131..350 CDD:239068 66/232 (28%)
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 13/61 (21%)
Peptidase_C1A 114..336 CDD:239068 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.