DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsf

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001029282.1 Gene:Ctsf / 361704 RGDID:1308181 Length:462 Species:Rattus norvegicus


Alignment Length:320 Identity:97/320 - (30%)
Similarity:160/320 - (50%) Gaps:28/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNA-DNGVSGFRLGVNTLADMTRKEIATL 100
            |.||:....:.| |.||..:|.::||..|  |......| |.|.:.:  |:...:|:|.:|..|:
  Rat   165 FKDFMTTYNRTYESREEAQWRLTVFARNM--IRAQKIQALDRGTAQY--GITKFSDLTEEEFHTI 225

  Fly   101 LGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALE 165
            .   ::...::.:.|.::...:.|..:   |..:|||:||.||....||: ||:||:|:.||.:|
  Rat   226 Y---LNPLLQKESGGKMSLAKSINDLA---PPEWDWRKKGAVTEVKDQGM-CGSCWAFSVTGNVE 283

  Fly   166 GHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRD-HGVTLANKYPYTQTEMQCRQ 229
            |..|...|.|.|||:|.|:||  |..:..|.||.....:..|:: .|:...:.|.|......|..
  Rat   284 GQWFLNRGTLLSLSEQELLDC--DKMDKACMGGLPSNAYTAIKNLGGLETEDDYGYQGHVQACNF 346

  Fly   230 NETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEE--C 292
            :....:      |.|.|...:: .||.|:...:|..||::.::||..:.|  |..||.....  |
  Rat   347 STQMAK------VYINDSVELS-RDENKIAAWLAQKGPISVAINAFGMQF--YRHGIAHPFRPLC 402

  Fly   293 NQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPIL 352
            :...::|:|.:||||..:...||.||||:.::|||.|:..:.|.:|. ||:.:..|..::
  Rat   403 SPWFIDHAVLLVGYGNRSNIPYWAIKNSWGRDWGEEGYYYLYRGSGA-CGVNTMASSAVV 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/60 (30%)
Peptidase_C1A 131..350 CDD:239068 75/221 (34%)
CtsfNP_001029282.1 Inhibitor_I29 165..221 CDD:214853 18/59 (31%)
Peptidase_C1 249..460 CDD:395062 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.