DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CtsB1

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:316 Identity:87/316 - (27%)
Similarity:127/316 - (40%) Gaps:73/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LGVNTLADMTRKEIATLLG-----------SKISEFGERYTNGHINFVTARNPASANLPEMFDWR 137
            :|.|..|.:|...|..|:|           .|....|:.|.|           :...|||.||.|
  Fly    41 VGRNFDASVTEGHIRRLMGVHPDA
HKFALPDKREVLGDLYVN-----------SVDELPEEFDSR 94

  Fly   138 EK-------GGVTPPGFQGVGCGACWSFATTGALEGHLFRRTG--VLASLSQQNLVDCADDYGNM 193
            ::       |.:...|    .||:||:|....|:...:...:|  |....|..:||.|....| .
  Fly    95 KQWPNCPTIGEIRDQG----SCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-F 154

  Fly   194 GCDGGFQEYGFEYIRDHGVTLANKY-------PYTQTEMQCRQNET------AGRPPRESLVKIR 245
            ||:|||....:.|....|:.....|       ||..:..:...|.|      .||.|:.|.|...
  Fly   155 GCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQS 219

  Fly   246 DYATITPGDE-------------EKMKEVIATLGPL--ACSMNADTISFEQYSGGIYEDEECNQG 295
            .|......|:             .:::|.|.|.||:  |.::..|.|   .|..|:|:.|  :..
  Fly   220 GYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLI---LYKDGVYQHE--HGK 279

  Fly   296 EL-NHSVTVVGYGT--ENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECS 348
            || .|::.::|:|.  |....||:|.||::.:||:.||.||||.. ..|||.|..|
  Fly   280 ELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIESSIS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 4/12 (33%)
Peptidase_C1A 131..350 CDD:239068 75/258 (29%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/22 (32%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.