DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctsla

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005165325.1 Gene:ctsla / 321453 ZFINID:ZDB-GENE-030131-106 Length:363 Species:Danio rerio


Alignment Length:349 Identity:129/349 - (36%)
Similarity:195/349 - (55%) Gaps:37/349 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ALLGAVSL-QQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGV 79
            |:..|.:| |||.        .::|.:.:...|.|...|..:|..|:...:..|.:.|.....|:
Zfish    40 AVFAAPTLDQQLN--------DHWDQWKKWHSKKYHATEEGWRRIIWEKNLKKIEMHNLEHSMGI 96

  Fly    80 SGFRLGVNTLADMTRKEIATLL-GSKISEFGERYTNGHI----NFVTARNPASANLPEMFDWREK 139
            ..:|||:|...|||.:|...:: |.|..:  :|...|.:    ||:        .:|...|||||
Zfish    97 HTYRLGMNHFGDMTHEEFRQVMNGFKHKK--DRRFRGSLFMEPNFI--------EVPNKLDWREK 151

  Fly   140 GGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGF 204
            |.|||...|| .||:||:|:|||||||.:||:||.|.|||:||||||:...||.||:||..:..|
Zfish   152 GYVTPVKDQG-ECGSCWAFSTTGALEGQMFRKTGKLVSLSEQNLVDCSRPEGNEGCNGGLMDQAF 215

  Fly   205 EYIRD-HGVTLANKYPYTQTEMQ-CRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGP 267
            :|::| :|:.....|||..|:.| |..:      |:.|......:..|..|.|..:.:.||.:||
Zfish   216 QYVKDQNGLDSEESYPYLGTDDQPCHFD------PKNSAANDTGFVDIPSGKERALMKAIAAVGP 274

  Fly   268 LACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNWGEG 328
            ::.:::|...||:.|..|||.::||:..||:|.|..||||.|    :|:.|||:|||:|:|||:.
Zfish   275 VSVAIDAGHESFQFYQSGIYYEKECSSEELDHGVLAVGYGFEGEDVDGKKYWIVKNSWSENWGDK 339

  Fly   329 GFMRILRNAGGFCGIASECSYPIL 352
            |::.:.::....||||:..|||::
Zfish   340 GYIYMAKDRHNHCGIATAASYPLV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 98/224 (44%)
ctslaXP_005165325.1 Inhibitor_I29 55..113 CDD:214853 16/57 (28%)
Peptidase_C1 142..362 CDD:278538 99/226 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.