DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctslb

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_571273.2 Gene:ctslb / 30443 ZFINID:ZDB-GENE-980526-285 Length:352 Species:Danio rerio


Alignment Length:351 Identity:119/351 - (33%)
Similarity:193/351 - (54%) Gaps:32/351 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ALLGAVSLQQLQSFPKLCDVQ---NFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADN 77
            |||..:.:..:.:.|.: |:|   :::.:..|.||.|.::..|.|..|:...:..|...|.....
Zfish    20 ALLVTLYISAVFAAPSI-DIQLDDHWNSWKSQHGKSYHEDVEVGRRMIWEENLRKIEQHNFEYSY 83

  Fly    78 GVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTARNPASAN-----LPEMFDWR 137
            |...|::|:|...|||.:|....:..        ||  |....|::.|....     .|:..|||
Zfish    84 GNHTFKMGMNQFGDMTNEEFRQAMNG--------YT--HDPNQTSQGPLFMEPSFFAAPQQVDWR 138

  Fly   138 EKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEY 202
            ::|.|||...| ..||:||||::||||||.|||:||.|.|:|:||||||:...||.||:||..:.
Zfish   139 QRGYVTPVKDQ-KQCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQ 202

  Fly   203 GFEYIRDH-GVTLANKYPY-TQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATL 265
            .|:|:::: |:.....||| .:.::.||.:      ||.::.||..:..|..|:|..:...:|.:
Zfish   203 AFQYVKENKGLDSEQSYPYLARDDLPCRYD------PRFNVAKITGFVDIPSGNELALMNAVAAV 261

  Fly   266 GPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTEN----GRDYWIIKNSYSQNWG 326
            ||::.:::|...|.:.|..|||.:..|:...|:|:|.|||||.:.    |..|||:|||:|..||
Zfish   262 GPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWG 326

  Fly   327 EGGFMRILRNAGGFCGIASECSYPIL 352
            :.|::.:.::....||:|::.|||::
Zfish   327 DKGYIYMAKDKNNHCGVATKASYPLM 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 89/224 (40%)
ctslbNP_571273.2 Inhibitor_I29 44..102 CDD:214853 16/57 (28%)
Peptidase_C1 131..351 CDD:306594 90/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.