DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsw

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001019413.1 Gene:Ctsw / 293676 RGDID:1309354 Length:371 Species:Rattus norvegicus


Alignment Length:383 Identity:106/383 - (27%)
Similarity:167/383 - (43%) Gaps:63/383 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MCSTMWLQMTLGLALLG---AVSLQQLQSFPKLCDVQN-FDDFLRQTGKVYSD-EERVYRESIFA 62
            |..|..|...|.|.|.|   :.||....:.|:..:::. |..|..|..:.||: .|...|..|||
  Rat     1 MTLTAHLFYFLALLLAGQGLSDSLLTKDAGPRPLELKEVFKLFQIQFNRSYSNPAEYTRRLGIFA 65

  Fly    63 AKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTARNPAS 127
            ..::......:. |.|.:.|  |....:|:|.:|...|.|.:.:.  ||..|      .|:...|
  Rat    66 HNLAQAQRLQEE-DLGTAEF--GQTPFSDLTEEEFGQLYGHQRAP--ERILN------MAKKVKS 119

  Fly   128 ----ANLPEMFDWRE-KGGVTPPGFQGVGCGACWSFATTGALEGHLFR-RTGVLASLSQQNLVDC 186
                .::|...|||: |..::....|| .|..||:.|....:: .|:| :|.....:|.|.|:||
  Rat   120 ERWGESVPPTCDWRKVKNIISSIKNQG-NCRCCWAIAAADNIQ-TLWRIKTQQFVDVSVQELLDC 182

  Fly   187 ADDYGNMGCDGGF--QEYGFEYIRDHGVTLANKYPYT--QTEMQCRQNETAGRPPRESLVKIRDY 247
             |..|| ||:|||  ..| ...:.:.|:.....||:.  |...:|..::      ...:..|:|:
  Rat   183 -DRCGN-GCNGGFVWDAY-ITVLNNSGLASEEDYPFQGHQKPHRCLADK------YRKVAWIQDF 238

  Fly   248 ATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYE--DEECNQGELNHSVTVVGYGTEN 310
             |:...:|:.:...:|..||:..::|...:.:  |..|:.:  ...|:...:||||.:||:|.|.
  Rat   239 -TMLSSNEQVIAGYLAIHGPITVTINMKLLQY--YQKGVIKATPSTCDPHLVNHSVLLVGFGKEK 300

  Fly   311 G-----------------RDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPI 351
            |                 ..|||:|||:...|||.|:.|:.| ....||||   .|||
  Rat   301 GGMQTGTLLSHSRKPRRSTPYWILKNSWGAEWGEKGYFRLYR-GNNTCGIA---KYPI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/59 (27%)
Peptidase_C1A 131..350 CDD:239068 69/243 (28%)
CtswNP_001019413.1 Inhibitor_I29 40..96 CDD:214853 16/58 (28%)
Peptidase_C1 126..356 CDD:278538 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.