DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsj

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_058817.1 Gene:Ctsj / 29174 RGDID:69241 Length:334 Species:Rattus norvegicus


Alignment Length:328 Identity:116/328 - (35%)
Similarity:173/328 - (52%) Gaps:40/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMT----RKEIA 98
            :.|:..:..|.||..|...:.:::...:.:|.|.||....|.:||.:.:|..||.|    ||.::
  Rat    29 WQDWKTKYAKSYSPVEEELKRAVWEENLKMIQLHNKENGLGKNGFTMEMNAFADTTGEEFRKSLS 93

  Fly    99 TLLGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGA 163
            .:|      .....||     .:|:...|..||...|||::|.|||...|| .||:||:||..||
  Rat    94 DIL------IPAAVTN-----PSAQKQVSIGLPNFKDWRKEGYVTPVRNQG-KCGSCWAFAAVGA 146

  Fly   164 LEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYI-RDHGVTLANKYPYTQTEMQC 227
            :||.:|.:||.|..||.|||:||:...||.||..|.....|.|: ::.|:.....|||...:..|
  Rat   147 IEGQMFSKTGNLTPLSVQNLLDCSKSEGNNGCRWGTAHQAFNYVLKNKGLEAEATYPYEGKDGPC 211

  Fly   228 R-QNETAGRPPRESLVKIRDYATIT-----PGDEEKMKEVIATLGPLACSMNADTISFEQYSGGI 286
            | .:|.|.             |.||     |.:|..:...:|::||::.:::|...||..||||:
  Rat   212 RYHSENAS-------------ANITGFVNLPPNELYLWVAVASIGPVSAAIDASHDSFRFYSGGV 263

  Fly   287 YEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASEC 347
            |.:..|:...:||:|.|||||.|    :|.:||:||||:.:.||..|||:|.::....|||||:.
  Rat   264 YHEPNCSSYVVNHAVLVVGYGFEGNETDGNNYWLIKNSWGEEWGINGFMKIAKDRNNHCGIASQA 328

  Fly   348 SYP 350
            |:|
  Rat   329 SFP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/62 (29%)
Peptidase_C1A 131..350 CDD:239068 91/229 (40%)
CtsjNP_058817.1 PTZ00203 4..319 CDD:185513 109/314 (35%)
Inhibitor_I29 29..87 CDD:214853 16/57 (28%)
Peptidase_C1 114..331 CDD:278538 92/230 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.