DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsr

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_783171.2 Gene:Ctsr / 290975 RGDID:631422 Length:334 Species:Rattus norvegicus


Alignment Length:354 Identity:125/354 - (35%)
Similarity:192/354 - (54%) Gaps:28/354 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MCSTMWLQ-MTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMS 66
            |.||.:|. :.||:. .||::..     |.| |.: :.|:..:..|.|:.||..:|.:::...|.
  Rat     1 MSSTFFLAILCLGVG-SGALAFD-----PSL-DAE-WHDWKTEYEKSYTMEEEGHRRAVWEENMK 57

  Fly    67 LITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTARNPASANLP 131
            :|.|.|:....|.:||.:.:|...|:|.:|...::   ::.....:..|.|  :..|:..:. ||
  Rat    58 MIKLHNRENSLGKNGFIMEMNEFGDLTAEEFRKMM---VNIPIRSHRKGKI--IRKRDVGNV-LP 116

  Fly   132 EMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCD 196
            :..|||:||.||....|.. |.:||:||.|||:||.:|.:||.|..||.||||||....||.||.
  Rat   117 KFVDWRKKGYVTRVQNQKF-CNSCWAFAVTGAIEGQMFNKTGQLTPLSVQNLVDCTKSQGNEGCQ 180

  Fly   197 GGFQEYGFEYIRDHGVTLAN-KYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKE 260
            .|.....:||:.::|...|. .|||...|..||.|      |:.|..:|..:.:: |..|:.:.|
  Rat   181 WGDPHIAYEYVLNNGGLEAEATYPYKGKEGVCRYN------PKHSKAEITGFVSL-PESEDILME 238

  Fly   261 VIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSY 321
            .:||:||::.:::|...||..|..|:|::..|:...:||||.|||||.|    :|..||:||||:
  Rat   239 AVATIGPISVAVDASFNSFGFYKKGLYDEPNCSNNTVNHSVLVVGYGFEGNETDGNSYWLIKNSW 303

  Fly   322 SQNWGEGGFMRILRNAGGFCGIASECSYP 350
            .:.||..|:|:|.::...||.|||...||
  Rat   304 GRKWGLRGYMKIPKDQNNFCAIASYAHYP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 91/223 (41%)
CtsrNP_783171.2 PTZ00203 7..332 CDD:185513 120/346 (35%)
Inhibitor_I29 29..87 CDD:214853 16/57 (28%)
Peptidase_C1A 116..332 CDD:239068 91/223 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.