DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Testin

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_775155.1 Gene:Testin / 286916 RGDID:708447 Length:333 Species:Rattus norvegicus


Alignment Length:329 Identity:108/329 - (32%)
Similarity:179/329 - (54%) Gaps:24/329 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTR 94
            |.| ||: ::::..:.||.|:..|...:.:::.....:|.|.|.....|...|.:.:|...|:|.
  Rat    23 PSL-DVE-WNEWRTKHGKTYNMNEERLKRAVWEKNFKMIELHNWEYLEGRHDFTMAMNAFGDLTN 85

  Fly    95 KEIATLL-GSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSF 158
            .|...:: |.:..:..:.:......|:        .:|:..|||:.|.|||...|| .|.:.|:|
  Rat    86 IEFVKMMTGFQRQKIKKTHIFQDHQFL--------YVPKRVDWRQLGYVTPVKNQG-HCASSWAF 141

  Fly   159 ATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDH-GVTLANKYPYTQ 222
            :.||:|||.:||:|..|..||:|||:||.......||.|||.:|.|:|::|: |:.....|||..
  Rat   142 SATGSLEGQMFRKTERLIPLSEQNLLDCMGSNVTHGCSGGFMQYAFQYVKDNGGLATEESYPYRG 206

  Fly   223 TEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIY 287
            ...:||.:      ...|...:||:..| ||.||.:.:.:|.:||::.:::|...||:.|..|||
  Rat   207 QGRECRYH------AENSAANVRDFVQI-PGSEEALMKAVAKVGPISVAVDASHGSFQFYGSGIY 264

  Fly   288 EDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECS 348
            .:.:|.:..|||:|.|||||.|    :|..:|::|||:.:.||..|:|::.::....||||:..:
  Rat   265 YEPQCKRVHLNHAVLVVGYGFEGEESDGNSFWLVKNSWGEEWGMKGYMKLAKDWSNHCGIATYST 329

  Fly   349 YPIL 352
            |||:
  Rat   330 YPIV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 12/58 (21%)
Peptidase_C1A 131..350 CDD:239068 86/223 (39%)
TestinNP_775155.1 Inhibitor_I29 29..87 CDD:214853 12/57 (21%)
Peptidase_C1 114..332 CDD:395062 87/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.