DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsj

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001343220.1 Gene:Ctsj / 26898 MGIID:1349426 Length:334 Species:Mus musculus


Alignment Length:350 Identity:128/350 - (36%)
Similarity:188/350 - (53%) Gaps:29/350 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MTLGLALL----GAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71
            ||..:.||    |..|..|... ||| |.: :.|:..:..|.||.:|...|.:::...|.:|.|.
Mouse     1 MTPTVLLLILCFGVASGAQAHD-PKL-DAE-WKDWKTKYAKSYSPKEEALRRAVWEENMRMIKLH 62

  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTARNPASANLPEMFDW 136
            ||....|.:.|.:.:|...|.|.:|....:.:  .......|:.|     |:|..|..||:..||
Mouse    63 NKENSLGKNNFTMKMNKFGDQTSEEFRKSIDN--IPIPAAMTDPH-----AQNHVSIGLPDYKDW 120

  Fly   137 REKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQE 201
            ||:|.|||...|| .||:||:||..||:||.:|.:||.|..||.|||:||:...||.||..|...
Mouse   121 REEGYVTPVRNQG-KCGSCWAFAAAGAIEGQMFWKTGNLTPLSVQNLLDCSKTVGNKGCQSGTAH 184

  Fly   202 YGFEYI-RDHGVTLANKYPYTQTEMQCR-QNETAGRPPRESLVKIRDYATITPGDEEKMKEVIAT 264
            ..|||: ::.|:.....|||...:..|| ::|.|.       ..|.||..:.| :|..:...:|:
Mouse   185 QAFEYVLKNKGLEAEATYPYEGKDGPCRYRSENAS-------ANITDYVNLPP-NELYLWVAVAS 241

  Fly   265 LGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNW 325
            :||::.:::|...||..|:||||.:..|:...:||:|.|||||:|    :|.:||:||||:.:.|
Mouse   242 IGPVSAAIDASHDSFRFYNGGIYYEPNCSSYFVNHAVLVVGYGSEGDVKDGNNYWLIKNSWGEEW 306

  Fly   326 GEGGFMRILRNAGGFCGIASECSYP 350
            |..|:|:|.::....|||||..|||
Mouse   307 GMNGYMQIAKDHNNHCGIASLASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 92/224 (41%)
CtsjNP_001343220.1 Inhibitor_I29 29..87 CDD:214853 16/57 (28%)
Peptidase_C1 114..331 CDD:306594 93/225 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.