DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsl

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_037288.1 Gene:Ctsl / 25697 RGDID:2448 Length:334 Species:Rattus norvegicus


Alignment Length:352 Identity:119/352 - (33%)
Similarity:187/352 - (53%) Gaps:36/352 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LALLGAVSLQQLQSFPKLCDVQN--FDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADN 77
            |.||..:.|....:.||.....|  :..:.....::|...|..:|.:::...|.:|.|.|....|
  Rat     4 LLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYSN 68

  Fly    78 GVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGV 142
            |..||.:.:|...|||.:|...::.      |.|:.. |......:.|....:|:..||||||.|
  Rat    69 GKHGFTMEMNAFGDMTNEEFRQIVN------GYRHQK-HKKGRLFQEPLMLQIPKTVDWREKGCV 126

  Fly   143 TPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYI 207
            ||...|| .||:||:|:.:|.|||.:|.:||.|.|||:||||||:.|.||.||:||..::.|:||
  Rat   127 TPVKNQG-QCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYI 190

  Fly   208 RDH-GVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATIT-------PGDEEKMKEVIAT 264
            ::: |:.....|||...:..|:..              .:||...       |..|:.:.:.:||
  Rat   191 KENGGLDSEESYPYEAKDGSCKYR--------------AEYAVANDTGFVDIPQQEKALMKPVAT 241

  Fly   265 LGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGY---GTENGRD-YWIIKNSYSQNW 325
            :||::.:|:|...|.:.||.|||.:..|:..:|:|.|.||||   ||::.:| ||::|||:.:.|
  Rat   242 VGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEW 306

  Fly   326 GEGGFMRILRNAGGFCGIASECSYPIL 352
            |..|:::|.::....||:|:..||||:
  Rat   307 GMDGYIKIAKDRNNHCGLATAASYPIV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/58 (26%)
Peptidase_C1A 131..350 CDD:239068 89/230 (39%)
CtslNP_037288.1 Inhibitor_I29 29..87 CDD:214853 15/57 (26%)
Peptidase_C1 114..332 CDD:278538 90/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.