DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsh

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_037071.1 Gene:Ctsh / 25425 RGDID:2447 Length:333 Species:Rattus norvegicus


Alignment Length:353 Identity:113/353 - (32%)
Similarity:175/353 - (49%) Gaps:34/353 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MCSTMWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSL 67
            :|:..||   |.......:::..::.|       :|..:::|..|.||..|..:|..:||.....
  Rat     8 LCAGAWL---LSAGATAELTVNAIEKF-------HFTSWMKQHQKTYSSREYSHRLQVFANNWRK 62

  Fly    68 ITLSNKNADNGVSGFRLGVNTLADMTRKEIA-TLLGSKISEFGERYTNGHINFVTARNPASANLP 131
            |...|:....    |::|:|..:||:..||. ..|.|:    .:..:....|::....|    .|
  Rat    63 IQAHNQRNHT----FKMGLNQFSDMSFAEIKHKYLWSE----PQNCSATKSNYLRGTGP----YP 115

  Fly   132 EMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCD 196
            ...|||:||.|..|......||:||:|:||||||..:...:|.:.:|::|.|||||.::.|.||.
  Rat   116 SSMDWRKKGNVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMMTLAEQQLVDCAQNFNNHGCQ 180

  Fly   197 GGFQEYGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKE 260
            ||.....|||| .:.|:...:.|||.....||:.|      |.:::..:::...||..||..|.|
  Rat   181 GGLPSQAFEYILYNKGIMGEDSYPYIGKNGQCKFN------PEKAVAFVKNVVNITLNDEAAMVE 239

  Fly   261 VIATLGPLACSMNADTISFEQYSGGIYEDEECNQ--GELNHSVTVVGYGTENGRDYWIIKNSYSQ 323
            .:|...|::.:... |..|..|..|:|....|::  .::||:|..||||.:||..|||:|||:..
  Rat   240 AVALYNPVSFAFEV-TEDFMMYKSGVYSSNSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGS 303

  Fly   324 NWGEGGFMRILRNAGGFCGIASECSYPI 351
            |||..|:..|.|.. ..||:|:..||||
  Rat   304 NWGNNGYFLIERGK-NMCGLAACASYPI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/58 (28%)
Peptidase_C1A 131..350 CDD:239068 83/221 (38%)
CtshNP_037071.1 Inhibitor_I29 33..88 CDD:400519 16/58 (28%)
Peptidase_C1 115..330 CDD:395062 84/222 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.