DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsc

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_058793.1 Gene:Ctsc / 25423 RGDID:2445 Length:462 Species:Rattus norvegicus


Alignment Length:313 Identity:96/313 - (30%)
Similarity:130/313 - (41%) Gaps:85/313 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LGSKISEFGER-YTNGHINFVTARN------------------------------------PAS- 127
            ||....::.|| |::.| |||.|.|                                    ||. 
  Rat   156 LGGLQEKYSERLYSHNH-NFVKAINSVQKSWTATTYEEYEKLSIRDLIRRSGHSGRILRPKPAPI 219

  Fly   128 --------ANLPEMFDWREKGGV--TPPGFQGVGCGACWSFATTGALEGHLFRRTGVLAS----- 177
                    .:|||.:|||...|:  ..|......||:|:|||:.|.||.    |..:|.:     
  Rat   220 TDEIQQQILSLPESWDWRNVRGINFVSPVRNQESCGSCYSFASLGMLEA----RIRILTNNSQTP 280

  Fly   178 -LSQQNLVDCADDYGNMGCDGGFQE-YGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPRES 240
             ||.|.:|.|: .|. .||||||.. ...:|.:|.||...|.:|||.|:..|:        |:|:
  Rat   281 ILSPQEVVSCS-PYA-QGCDGGFPYLIAGKYAQDFGVVEENCFPYTATDAPCK--------PKEN 335

  Fly   241 LVKIRDYATITPG------DEEKMKEVIATLGPLACSMNADTISFEQYSGGIYE----DEECNQG 295
            .::.........|      :|..||..:...||:|.:..... .|..|..|||.    .:..|..
  Rat   336 CLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHD-DFLHYHSGIYHHTGLSDPFNPF 399

  Fly   296 EL-NHSVTVVGYGTE--NGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIAS 345
            || ||:|.:||||.:  .|.||||:|||:...|||.|:.||.|.... |.|.|
  Rat   400 ELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDE-CAIES 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 82/237 (35%)
CtscNP_058793.1 CathepsinC_exc 25..138 CDD:400909
Pox_I6 168..>204 CDD:333259 7/36 (19%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 83/238 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.