DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsq

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_640355.1 Gene:Ctsq / 246147 RGDID:631421 Length:343 Species:Rattus norvegicus


Alignment Length:334 Identity:114/334 - (34%)
Similarity:176/334 - (52%) Gaps:35/334 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIA 98
            ||| :.::..:..|:||.||.|.:..::...:..|.|.|:....|.:.:.:.:|..||||.:|..
  Rat    26 DVQ-WQEWKIKYEKLYSPEEEVLKRVVWEENVKKIELHNRENSLGKNTYTMEINDFADMTDEEFK 89

  Fly    99 -TLLGSKI-----------SEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVG 151
             .::|.::           ...|..:.|.. |:..|       ||:..|||.:|.||....|| |
  Rat    90 DMIIGFQLPVHNTEKRLWKRALGSFFPNSW-NWRDA-------LPKFVDWRNEGYVTRVRKQG-G 145

  Fly   152 CGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYI-RDHGVTLA 215
            |.:||:|..|||:||.:|::||.|..||.|||:||:...||.||..|.....|:|: .:.|:...
  Rat   146 CSSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLIDCSKPQGNRGCLWGNTYNAFQYVLHNGGLEAE 210

  Fly   216 NKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFE 280
            ..|||.:.|..||.|      |:.|..||..: .:.|..|:.:.:.:||.||:|..::..:.||.
  Rat   211 ATYPYERKEGVCRYN------PKNSSAKITGF-VVLPESEDVLMDAVATKGPIATGVHVISSSFR 268

  Fly   281 QYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNWGEGGFMRILRNAGGFC 341
            .|..|:|.:.:|: ..:||:|.|||||.|    :|.:||:||||:.:.||..|:|:|.::....|
  Rat   269 FYQKGVYHEPKCS-SYVNHAVLVVGYGFEGNETDGNNYWLIKNSWGKRWGLRGYMKIAKDRNNHC 332

  Fly   342 GIASECSYP 350
            .|||...||
  Rat   333 AIASLAQYP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/58 (26%)
Peptidase_C1A 131..350 CDD:239068 87/223 (39%)
CtsqNP_640355.1 PTZ00203 4..341 CDD:185513 112/332 (34%)
Inhibitor_I29 29..87 CDD:214853 15/57 (26%)
Peptidase_C1 125..342 CDD:278538 90/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.