DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and BC051665

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_954599.2 Gene:BC051665 / 218275 MGIID:2682300 Length:330 Species:Mus musculus


Alignment Length:350 Identity:116/350 - (33%)
Similarity:190/350 - (54%) Gaps:31/350 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71
            ::|..||.|.::.|.....    |.|..|  ::::..:..|.|:..|...:.:::...|.:|.|.
Mouse     4 VFLLATLCLGVVSAAPAHD----PSLDAV--WEEWKTKHRKTYNMNEEAQKRAVWENNMKMIGLH 62

  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTN----GHINFVTARNPASANLPE 132
            |::...|..||.|.:|...|:|.           :||.|..|.    ||......:.|...::|:
Mouse    63 NEDYLKGKHGFNLEMNAFGDLTN-----------TEFRELMTGFQSMGHKEMTIFQEPLLGDVPK 116

  Fly   133 MFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDG 197
            ..|||:.|.|||...|| .||:||:|:..|:|||.:||:||.|..||:|||:||:..|||:||:|
Mouse   117 SVDWRDHGYVTPVKDQG-HCGSCWAFSAVGSLEGQIFRKTGKLVPLSEQNLMDCSWSYGNVGCNG 180

  Fly   198 GFQEYGFEYIRDH-GVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEV 261
            |..|..|:|:::: |:.....|.|...:..||.:      |:.|.|.|..:..: |..|:.:...
Mouse   181 GLMELAFQYVKENRGLDTRESYAYEAWDGPCRYD------PKYSAVNITGFVKV-PLSEDALMNA 238

  Fly   262 IATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE-NGRDYWIIKNSYSQNW 325
            :|::||::..::....||..|.||.|.:.:|:...|:|:|.|||||.| :||.||::|||:.::|
Mouse   239 VASVGPVSVGIDTHHHSFRFYRGGTYYEPDCSSTNLDHAVLVVGYGEESDGRKYWLVKNSWGEDW 303

  Fly   326 GEGGFMRILRNAGGFCGIASECSYP 350
            |..|::::.::....||||:...||
Mouse   304 GMDGYIKMAKDRDNNCGIATYAIYP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 14/58 (24%)
Peptidase_C1A 131..350 CDD:239068 85/220 (39%)
BC051665NP_954599.2 PTZ00203 7..326 CDD:185513 113/343 (33%)
Inhibitor_I29 29..87 CDD:214853 14/68 (21%)
Peptidase_C1 114..329 CDD:278538 86/222 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.