DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Y113G7B.15

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_507904.2 Gene:Y113G7B.15 / 190976 WormBaseID:WBGene00013764 Length:362 Species:Caenorhabditis elegans


Alignment Length:342 Identity:99/342 - (28%)
Similarity:153/342 - (44%) Gaps:40/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VQNFDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIA 98
            :.:|::|.....|.| :..|:..|.:.||.....|...|..|.........|.|..||..|:|::
 Worm    27 LSHFNNFTMHHKKHYRTPAEKDRRLAHFAKNHQKIQELNAKARREGRNVTFGWNKFADKNRQELS 91

  Fly    99 TLLGSKISE--------FGERYTNGHINFVTARNP-ASANLPEMFDWREKGGVTPPGFQGVG--- 151
            . ..|||..        :..|:..|..|....|:. .|.::|:.||.|:   :...|...||   
 Worm    92 A-RNSKIHPKNHTDLPIYKPRHPRGSRNHHNKRSKRQSGDIPDYFDLRD---IYVDGSPVVGPVK 152

  Fly   152 ----CGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGV 212
                ||.||:||||...|......:....|||.|.:.||||.....||.||....|.:.:...|.
 Worm   153 DQEQCGCCWAFATTAITEAANTLYSKSFTSLSDQEICDCADSGDTPGCVGGDPRNGLKMVHLRGQ 217

  Fly   213 TLANKYPYTQ----TEMQCRQNE--TAGRPPRESLVKI-RDYATITPGDEEKMKEVIATLGPLAC 270
            :....|||.:    |...|..:|  |..:|...::.:. :|||     :|:.|:.:.....|.|.
 Worm   218 SSDGDYPYEEYRANTTGNCVGDEKSTVIQPETLNVYRFDQDYA-----EEDIMENLYLNHIPTAV 277

  Fly   271 SMNADTISFEQYSGGIYEDEECNQ---GELNHSVTVVGYGT-ENGRDYWIIKNSYSQNWGEGGFM 331
            ...... :||.|:.|:.:.|:|.|   .|. |||.:||||| ::|..||:::||::.:||..|::
 Worm   278 YFRVGE-NFEWYTSGVLQSEDCYQMTPAEW-HSVAIVGYGTSDDGVPYWLVRNSWNSDWGLHGYV 340

  Fly   332 RILRNAGGFCGIASECS 348
            :|.|.. .:|.|.|..:
 Worm   341 KIRRGV-NWCLIESHAA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/59 (27%)
Peptidase_C1A 131..350 CDD:239068 74/236 (31%)
Y113G7B.15NP_507904.2 Inhibitor_I29 30..90 CDD:285458 16/59 (27%)
Peptidase_C1A 132..358 CDD:239068 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.