DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and F15D4.4

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_496805.3 Gene:F15D4.4 / 184530 WormBaseID:WBGene00008861 Length:608 Species:Caenorhabditis elegans


Alignment Length:338 Identity:84/338 - (24%)
Similarity:142/338 - (42%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADM 92
            :|..|.||.||:...::..|.::...:|.:|         :...|...:.|:|.:::..|..:..
 Worm   134 AFKSLMDVINFNSTAKEGLKRFNVYSKVKKE---------VDEHNIMYELGMSSYKMSTNQFSVA 189

  Fly    93 TRKEIATLLGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTP---------PGFQ 148
            ...|:|.|.               :| :.|..|.:..:|.....|:|....|         |...
 Worm   190 LDGEVAPLT---------------LN-LDALTPTATVIPATISSRKKRDTEPTVDWRPFLKPILD 238

  Fly   149 GVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDC----ADDYG--NMGCDGGFQEYGFEYI 207
            ...||.||:|:....:|.....:....:|||.|.|:.|    ...||  |:||.||:.:....|:
 Worm   239 QSTCGGCWAFSMISMIESFFAIQGYNTSSLSVQQLLTCDTKVDSTYGLANVGCKGGYFQIAGSYL 303

  Fly   208 RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRD------------YATITPGDEEKMKE 260
            .......|:..|:...:..|   :::..||....:.:.|            ..|:....|:|:::
 Worm   304 EVSAARDASLIPFDLEDTSC---DSSFFPPVVPTILLFDDGYISGNFTAAQLITMEQNIEDKVRK 365

  Fly   261 VIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNW 325
                 ||:|..|.|.. ...:||.|:| |.:|.. .:||:|.:||: |:   |||||:||:..:|
 Worm   366 -----GPIAVGMAAGP-DIYKYSEGVY-DGDCGT-IINHAVVIVGF-TD---DYWIIRNSWGASW 418

  Fly   326 GEGGFMRILRNAG 338
            ||.|:.|:.|..|
 Worm   419 GEAGYFRVKRTPG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 8/58 (14%)
Peptidase_C1A 131..350 CDD:239068 65/235 (28%)
F15D4.4NP_496805.3 Inhibitor_I29 <146..187 CDD:214853 7/49 (14%)
Peptidase_C1A 227..442 CDD:239068 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.