DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL2 and C32B5.13

DIOPT Version :10

Sequence 1:NP_610906.1 Gene:CtsL2 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_493866.1 Gene:C32B5.13 / 183116 WormBaseID:WBGene00016306 Length:150 Species:Caenorhabditis elegans


Alignment Length:154 Identity:51/154 - (33%)
Similarity:73/154 - (47%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SLSQQNLVDCADDYGNM--GCDGGFQEYGFEYIRDHGVTLANKYPYTQTEMQ-CRQNETAGRPPR 238
            |.|:|.::||    ||.  .|......:  |:|:.:||.....|||...|.: |:.:|.      
 Worm    12 SFSEQQIIDC----GNFTSPCQENILSH--EFIKKNGVVTEADYPYVGKENEKCKYDEN------ 64

  Fly   239 ESLVKIRDYAT--ITPGD--EEKMKEVIATLGPLACSMNADTISFEQYSGGIYE--DEECNQGEL 297
                ||:.:.|  :..|:  |..:|..|...||....|.|.. ||..|..|||.  .|||.:...
 Worm    65 ----KIKLWPTNMLLVGNLPETLLKLFIKEHGPGYFRMKAPP-SFFNYKTGIYSPTQEECGKATD 124

  Fly   298 NHSVTVVGYGTENGRDYWIIKNSY 321
            ..|:|:||||.|.|::|||:|.|:
 Worm   125 ARSLTIVGYGIEGGQNYWIVKGSF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL2NP_610906.1 Inhibitor_I29 38..97 CDD:462410
Peptidase_C1A 131..350 CDD:239068 51/154 (33%)
C32B5.13NP_493866.1 Peptidase_C1 1..150 CDD:451520 51/154 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.