DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and C32B5.7

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001293573.1 Gene:C32B5.7 / 183111 WormBaseID:WBGene00016300 Length:234 Species:Caenorhabditis elegans


Alignment Length:228 Identity:64/228 - (28%)
Similarity:99/228 - (43%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LLGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGAL 164
            ::|:.:.:..:.|.|       |:.|       ..|||::|.|.|...|| .|.|.::||...|:
 Worm    36 IIGALVQQRTQNYKN-------AKKP-------FLDWRDEGVVGPVKDQG-NCNASYAFAAISAI 85

  Fly   165 EGHLFRRTGVLASLSQQNLVDCADDYGNMGC----DGGFQEYGFEYIRDHGVTLANKYPYTQTEM 225
            |.......|.|.|.|:|.::||..     ||    |   ......|:...|:.....||:..   
 Worm    86 ESMYAIANGQLLSFSEQQIIDCLG-----GCAIESD---PMMAMTYLERKGIETYTDYPFVG--- 139

  Fly   226 QCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYE-- 288
              ::||......:::.:.:.|  |....||......|...||...:||... ||..|..|||.  
 Worm   140 --KKNEKCEYDSKKAYLILDD--TYDMSDESLALVFIDERGPGLFTMNTPP-SFFNYKSGIYNPT 199

  Fly   289 DEECNQGELNHSVTVVGYGTENGRDYWIIKNSY 321
            :|||.......::|:||||.:.|::|||:|.|:
 Worm   200 EEECKSTNEKRALTIVGYGNDKGQNYWIVKGSF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 59/197 (30%)
C32B5.7NP_001293573.1 Peptidase_C1A 56..234 CDD:239068 59/194 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.