DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and cpr-4

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_504682.1 Gene:cpr-4 / 179053 WormBaseID:WBGene00000784 Length:335 Species:Caenorhabditis elegans


Alignment Length:257 Identity:64/257 - (24%)
Similarity:107/257 - (41%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LPEMFDWREKGGVTPPGFQGVG-------CGACWSFATTGALEGH--LFRRTGVLASLSQQNLVD 185
            :|..||.|.:.    |....:.       ||:||:||...|....  :.....|...||.::::.
 Worm    81 IPATFDARTQW----PNCMSINNIRDQSDCGSCWAFAAAEAASDRFCIASNGAVNTLLSAEDVLS 141

  Fly   186 CADDYGNMGCDGGFQEYGFEYIRDHGVTLANKYPYTQTEMQCRQ------NETAGR--------- 235
            |..:.| .||:||:....::|:...|......|   :.:..|:.      .||.|.         
 Worm   142 CCSNCG-YGCEGGYPINAWKYLVKSGFCTGGSY---EAQFGCKPYSLAPCGETVGNVTWPSCPDD 202

  Fly   236 ----PPRESLVKIRDYATITPGDE----------EKMKEVIATL---GPLACSMNADTI--SFEQ 281
                |...:....::|......|:          :|:.::.|.:   ||:..   |.|:  .|.|
 Worm   203 GYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVSQIQAEIIAHGPVEA---AFTVYEDFYQ 264

  Fly   282 YSGGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGI 343
            |..|:|. ....|....|::.::|:||:||..||::.||::.||||.|:.||:|.... |||
 Worm   265 YKTGVYV-HTTGQELGGHAIRILGWGTDNGTPYWLVANSWNVNWGENGYFRIIRGTNE-CGI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 64/256 (25%)
cpr-4NP_504682.1 Peptidase_C1A_CathepsinB 82..331 CDD:239111 64/256 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.