DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and cpz-1

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_491023.2 Gene:cpz-1 / 171829 WormBaseID:WBGene00000788 Length:306 Species:Caenorhabditis elegans


Alignment Length:239 Identity:77/239 - (32%)
Similarity:121/239 - (50%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SANLPEMFDWREKGGVT---------PPGFQGVGCGACWSFATTGALEGHL-FRRTGV--LASLS 179
            |.:||:.:|||:..|:.         .|.:    ||:||:|..|.||...: .:|...  .|.||
 Worm    62 SEDLPKTWDWRDANGINYASADRNQHIPQY----CGSCWAFGATSALADRINIKRKNAWPQAYLS 122

  Fly   180 QQNLVDCADDYGNMGCDGGFQEYG-FEYIRDHGVTLANKYPYTQTEMQCRQNETAGRP-PRE--- 239
            .|.::||:   |...|..|.:..| ::|..:||:.......|...:.:|......|.. |.|   
 Worm   123 VQEVIDCS---GAGTCVMGGEPGGVYKYAHEHGIPHETCNNYQARDGKCDPYNRCGSCWPGECFS 184

  Fly   240 ----SLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHS 300
                :|.|:.:|.|:  ...||||..|...||:||.: |.|.:||.|:||||  :|....:::|.
 Worm   185 IKNYTLYKVSEYGTV--HGYEKMKAEIYHKGPIACGI-AATKAFETYAGGIY--KEVTDEDIDHI 244

  Fly   301 VTVVGYGT--ENGRDYWIIKNSYSQNWGEGGFMRIL----RNAG 338
            ::|.|:|.  |:|.:|||.:||:.:.|||.|:.:|:    :|||
 Worm   245 ISVHGWGVDHESGVEYWIGRNSWGEPWGEHGWFKIVTSQYKNAG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 75/235 (32%)
cpz-1NP_491023.2 Peptidase_C1A_CathepsinX 65..305 CDD:239149 76/236 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3812
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.