DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CTSW

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:365 Identity:91/365 - (24%)
Similarity:154/365 - (42%) Gaps:67/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGF 82
            ||...|:..::| ||..:|....:|       |.||..:|..|||..::......:. |.|.:.|
Human    31 LGPQPLELKEAF-KLFQIQFNRSYL-------SPEEHAHRLDIFAHNLAQAQRLQEE-DLGTAEF 86

  Fly    83 RLGVNTLADMTRKEIATLLGSKISEFGERYTNGHI----NFVTARNPASANLPEMFDWREKGGVT 143
              ||...:|:|.:|...|       :|.|...|.:    ..:.:..| ..::|...|||:.....
Human    87 --GVTPFSDLTEEEFGQL-------YGYRRAAGGVPSMGREIRSEEP-EESVPFSCDWRKVASAI 141

  Fly   144 PPGFQGVGCGACWSFATTGALEGHLFRRT-GVLASLSQQNLVDCADDYGNM--GCDGGFQEYGF- 204
            .|......|..||:.|..|.:| .|:|.: .....:|.|.|:||    |..  ||.|||....| 
Human   142 SPIKDQKNCNCCWAMAAAGNIE-TLWRISFWDFVDVSVQELLDC----GRCGDGCHGGFVWDAFI 201

  Fly   205 EYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPR-ESLVKIRDYATITPGDEEKMKEVIATLGPL 268
            ..:.:.|:.....||:     |.:.......|.: :.:..|:|:..: ..:|.::.:.:||.||:
Human   202 TVLNNSGLASEKDYPF-----QGKVRAHRCHPKKYQKVAWIQDFIML-QNNEHRIAQYLATYGPI 260

  Fly   269 ACSMNADTISFEQYSGGIYE--DEECNQGELNHSVTVVGYGTENGRD------------------ 313
            ..::|...:  :.|..|:.:  ...|:...::|||.:||:|:....:                  
Human   261 TVTINMKPL--QLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHP 323

  Fly   314 --YWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPI 351
              |||:|||:...|||.|:.|:.|.: ..|||.   .:|:
Human   324 TPYWILKNSWGAQWGEKGYFRLHRGS-NTCGIT---KFPL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/58 (26%)
Peptidase_C1A 131..350 CDD:239068 62/245 (25%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 19/66 (29%)
Peptidase_C1A 129..358 CDD:239068 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.