DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CTSL

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens


Alignment Length:318 Identity:116/318 - (36%)
Similarity:175/318 - (55%) Gaps:38/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGER 111
            ::|...|..:|.:::...|.:|.|.|:....|...|.:.:|...|||.:|...::          
Human    38 RLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVM---------- 92

  Fly   112 YTNGHINFVTARNPASANL---------PEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGH 167
              ||..|    |.|....:         |...||||||.|||...|| .||:||:|:.||||||.
Human    93 --NGFQN----RKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQG-QCGSCWAFSATGALEGQ 150

  Fly   168 LFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDH-GVTLANKYPYTQTEMQCRQNE 231
            :||:||.|.|||:||||||:...||.||:||..:|.|:|::|: |:.....|||..||..|:.| 
Human   151 MFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYN- 214

  Fly   232 TAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGE 296
                 |:.|:.....:..| |..|:.:.:.:||:||::.:::|...||..|..|||.:.:|:..:
Human   215 -----PKYSVANDTGFVDI-PKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSED 273

  Fly   297 LNHSVTVVGYGTE----NGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYP 350
            ::|.|.|||||.|    :...||::|||:.:.||.||::::.::....|||||..|||
Human   274 MDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 13/49 (27%)
Peptidase_C1A 131..350 CDD:239068 95/223 (43%)
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 13/48 (27%)
Peptidase_C1 114..332 CDD:395062 97/226 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149669
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.