DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CTSH

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens


Alignment Length:356 Identity:125/356 - (35%)
Similarity:181/356 - (50%) Gaps:38/356 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MCSTMWLQMTLGLALLGAVSL--QQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKM 65
            :|:..||   ||:.:.||..|  ..|:.|       :|..::.:..|.||.||..:|...||:..
Human     8 LCAGAWL---LGVPVCGAAELCVNSLEKF-------HFKSWMSKHRKTYSTEEYHHRLQTFASNW 62

  Fly    66 SLITLSNKNADNGVSGFRLGVNTLADMTRKEIA-TLLGSKISEFGERYTNGHINFVTARNPASAN 129
            ..|...|    ||...|::.:|..:||:..||. ..|.|:    .:..:....|::....|    
Human    63 RKINAHN----NGNHTFKMALNQFSDMSFAEIKHKYLWSE----PQNCSATKSNYLRGTGP---- 115

  Fly   130 LPEMFDWREKGG-VTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNM 193
            .|...|||:||. |:|...|| .||:||:|:||||||..:...||.:.||::|.|||||.|:.|.
Human   116 YPPSVDWRKKGNFVSPVKNQG-ACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNH 179

  Fly   194 GCDGGFQEYGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEK 257
            ||.||.....|||| .:.|:...:.|||...:..|:..      |.:::..::|.|.||..|||.
Human   180 GCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQ------PGKAIGFVKDVANITIYDEEA 238

  Fly   258 MKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQ--GELNHSVTVVGYGTENGRDYWIIKNS 320
            |.|.:|...|::.:... |..|..|..|||....|::  .::||:|..||||.:||..|||:|||
Human   239 MVEAVALYNPVSFAFEV-TQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNS 302

  Fly   321 YSQNWGEGGFMRILRNAGGFCGIASECSYPI 351
            :...||..|:..|.|.. ..||:|:..||||
Human   303 WGPQWGMNGYFLIERGK-NMCGLAACASYPI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 17/58 (29%)
Peptidase_C1A 131..350 CDD:239068 89/222 (40%)
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 17/58 (29%)
Peptidase_C1 117..332 CDD:278538 90/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.