DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsk

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_031828.2 Gene:Ctsk / 13038 MGIID:107823 Length:329 Species:Mus musculus


Alignment Length:349 Identity:124/349 - (35%)
Similarity:193/349 - (55%) Gaps:27/349 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MWLQMTLGLALLG-AVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDE-ERVYRESIFAAKMSLIT 69
            ||:...|.|.::. |:|.::      :.|.| ::.:.:...|.|:.: :.:.|..|:...:..|:
Mouse     1 MWVFKFLLLPMVSFALSPEE------MLDTQ-WELWKKTHQKQYNSKVDEISRRLIWEKNLKQIS 58

  Fly    70 LSNKNADNGVSGFRLGVNTLADMTRKEIA-TLLGSKISEFGERYTNGHINFVTARNPA-SANLPE 132
            ..|..|..||..:.|.:|.|.|||.:|:. .:.|.:|.. ...|:|.     |...|. ...:|:
Mouse    59 AHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLRIPP-SRSYSND-----TLYTPEWEGRVPD 117

  Fly   133 MFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDG 197
            ..|:|:||.|||...|| .||:||:|::.|||||.|.::||.|.:||.||||||..:  |.||.|
Mouse   118 SIDYRKKGYVTPVKNQG-QCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTE--NYGCGG 179

  Fly   198 GFQEYGFEYIRDH-GVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEV 261
            |:....|:|::.: |:...:.|||...:..|..|.||      ...|.|.|..|..|:|:.:|..
Mouse   180 GYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATA------KAAKCRGYREIPVGNEKALKRA 238

  Fly   262 IATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWG 326
            :|.:||::.|::|...||:.||.|:|.||.|::..:||:|.||||||:.|..:||||||:.::||
Mouse   239 VARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWG 303

  Fly   327 EGGFMRILRNAGGFCGIASECSYP 350
            ..|:..:.||....|||.:..|:|
Mouse   304 NKGYALLARNKNNACGITNMASFP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/59 (25%)
Peptidase_C1A 131..350 CDD:239068 93/219 (42%)
CtskNP_031828.2 Inhibitor_I29 26..85 CDD:214853 15/58 (26%)
Peptidase_C1A 116..327 CDD:239068 93/219 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.