DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsh

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_031827.2 Gene:Ctsh / 13036 MGIID:107285 Length:333 Species:Mus musculus


Alignment Length:353 Identity:115/353 - (32%)
Similarity:175/353 - (49%) Gaps:34/353 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MCSTMWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSL 67
            :|:..||..|      ||.:...:.:..|.    :|..:::|..|.||..|..:|..:||.....
Mouse     8 LCAGAWLLST------GATAELTVNAIEKF----HFKSWMKQHQKTYSSVEYNHRLQMFANNWRK 62

  Fly    68 ITLSNKNADNGVSGFRLGVNTLADMTRKEIA-TLLGSKISEFGERYTNGHINFVTARNPASANLP 131
            |...|:....    |::.:|..:||:..||. ..|.|:    .:..:....|::....|    .|
Mouse    63 IQAHNQRNHT----FKMALNQFSDMSFAEIKHKFLWSE----PQNCSATKSNYLRGTGP----YP 115

  Fly   132 EMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCD 196
            ...|||:||.|..|......||:||:|:||||||..:...:|.:.||::|.|||||..:.|.||.
Mouse   116 SSMDWRKKGNVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCK 180

  Fly   197 GGFQEYGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKE 260
            ||.....|||| .:.|:...:.|||...:..||.|      |::::..:::...||..||..|.|
Mouse   181 GGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFN------PQKAVAFVKNVVNITLNDEAAMVE 239

  Fly   261 VIATLGPLACSMNADTISFEQYSGGIYEDEECNQ--GELNHSVTVVGYGTENGRDYWIIKNSYSQ 323
            .:|...|::.:... |..|..|..|:|..:.|::  .::||:|..||||.:||..|||:|||:..
Mouse   240 AVALYNPVSFAFEV-TEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGS 303

  Fly   324 NWGEGGFMRILRNAGGFCGIASECSYPI 351
            .|||.|:..|.|.. ..||:|:..||||
Mouse   304 QWGENGYFLIERGK-NMCGLAACASYPI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/58 (26%)
Peptidase_C1A 131..350 CDD:239068 84/221 (38%)
CtshNP_031827.2 Inhibitor_I29 33..88 CDD:285458 15/58 (26%)
Peptidase_C1 115..330 CDD:278538 85/222 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.