DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsb

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_031824.1 Gene:Ctsb / 13030 MGIID:88561 Length:339 Species:Mus musculus


Alignment Length:385 Identity:94/385 - (24%)
Similarity:140/385 - (36%) Gaps:106/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71
            ||..:.|...||...|.....||..|.|                               .||...
Mouse     1 MWWSLILLSCLLALTSAHDKPSFHPLSD-------------------------------DLINYI 34

  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLLGS-KIS---EFGERYTNGHINFVTARNPASANLPE 132
            ||......:| |...|......:|...|:||. |:.   .|||                ..:|||
Mouse    35 NKQNTTWQAG-RNFYNVDISYLKKLCGTVLGGPKLPGRVAFGE----------------DIDLPE 82

  Fly   133 MFDWREK-------GGVTPPGFQGVGCGACWSFATTGALEGHLFRRTG--VLASLSQQNLVDCAD 188
            .||.||:       |.:...|    .||:||:|....|:.......|.  |...:|.::|:.|..
Mouse    83 TFDAREQWSNCPTIGQIRDQG----SCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCG 143

  Fly   189 DYGNMGCDGGFQEYGFEYIRDHGVTLANKY-------PYTQTEMQCRQNETAGRPP--------- 237
            .....||:||:....:.:....|:.....|       |||..  .|..:....|||         
Mouse   144 IQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIP--PCEHHVNGSRPPCTGEGDTPR 206

  Fly   238 ---------RESLVKIRDYATITPGDEEKMKEVIATL---GPLACSMNADTI--SFEQYSGGIYE 288
                     ..|..:.:.:...:......:||::|.:   ||:.   .|.|:  .|..|..|:|:
Mouse   207 CNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVE---GAFTVFSDFLTYKSGVYK 268

  Fly   289 DEECNQGEL--NHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASE 346
            .|   .|::  .|::.::|:|.|||..||:..||::.:||:.||.:|||.. ..|||.||
Mouse   269 HE---AGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGE-NHCGIESE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 8/58 (14%)
Peptidase_C1A 131..350 CDD:239068 68/257 (26%)
CtsbNP_031824.1 Propeptide_C1 26..65 CDD:285358 12/70 (17%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.