DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and CTSC

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:345 Identity:109/345 - (31%)
Similarity:146/345 - (42%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TG-KVYSDEERVYRESIFAAKMSLITLSN---KNADNGVSGFRLGVNTLADMTRKEIATL-LGSK 104
            || ||.:..|.|| .:|...|.|....||   |...|.|........:....|..|..|| ||..
Human   138 TGKKVGTASENVY-VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDM 201

  Fly   105 ISEFGERYTNGHINFVTARNPAS---------ANLPEMFDWREKGGV--TPPGFQGVGCGACWSF 158
            |     |.:.||...:....||.         .:||..:|||...|:  ..|......||:|:||
Human   202 I-----RRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSF 261

  Fly   159 ATTGALEGHLFRRTGVLAS------LSQQNLVDCADDYGNMGCDGGFQE-YGFEYIRDHGVTLAN 216
            |:.|.||.    |..:|.:      ||.|.:|.|: .|. .||:|||.. ...:|.:|.|:....
Human   262 ASMGMLEA----RIRILTNNSQTPILSPQEVVSCS-QYA-QGCEGGFPYLIAGKYAQDFGLVEEA 320

  Fly   217 KYPYTQTEMQCRQNETAGRPPRESLVKIRDYAT---ITPG-----DEEKMKEVIATLGPLACSMN 273
            .:|||.|:..|:..|..          .|.|::   ...|     :|..||..:...||:|    
Human   321 CFPYTGTDSPCKMKEDC----------FRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMA---- 371

  Fly   274 ADTISFE------QYSGGIYED----EECNQGEL-NHSVTVVGYGTE--NGRDYWIIKNSYSQNW 325
               ::||      .|..|||..    :..|..|| ||:|.:|||||:  :|.||||:|||:...|
Human   372 ---VAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGW 433

  Fly   326 GEGGFMRILRNAGGFCGIAS 345
            ||.|:.||.|.... |.|.|
Human   434 GENGYFRIRRGTDE-CAIES 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/55 (29%)
Peptidase_C1A 131..350 CDD:239068 81/245 (33%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344 109/345 (32%)
Peptidase_C1A_CathepsinC 231..460 CDD:239112 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.