DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and Ctsq

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_083912.2 Gene:Ctsq / 104002 MGIID:2137385 Length:343 Species:Mus musculus


Alignment Length:366 Identity:123/366 - (33%)
Similarity:178/366 - (48%) Gaps:62/366 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADN 77
            |.|.:|..||     :|....||: :.:::....|:||.||.|.|.:|:...:..|.|.|:....
Mouse    10 LCLGILSGVS-----AFDPSLDVE-WKEWMGSFEKLYSPEEEVLRRAIWEENVKRIKLHNRENSL 68

  Fly    78 GVSGFRLGVNTLADMTRKEI------ATL-------------LGSKISEFGERYTNGHINFVTAR 123
            |.:.:.:|:|..||||.:|.      |||             |||..                  
Mouse    69 GKNTYTMGLNGFADMTDEEFMNIVIGATLPVDNTRKSLWKRALGSPF------------------ 115

  Fly   124 NPAS----ANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLV 184
             |.|    ..||:..|||.:|.||....|. .|.:||:|..|||:||.:|::||.|..||.||||
Mouse   116 -PKSWYWKDALPKFVDWRNEGYVTRVRNQR-NCNSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLV 178

  Fly   185 DCADDYGNMGCDGGFQEYGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYA 248
            ||:...||.||..|....||:|: .:.|:.....|||...|..||.|      |:.|..||..: 
Mouse   179 DCSRPQGNRGCRWGNTYNGFQYVLHNGGLEAQATYPYEGKEGLCRYN------PKNSAAKITGF- 236

  Fly   249 TITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYG----TE 309
            .:.|..|:.:.:.:||.||:|..::..:.||..|.||:|.:..|. ..:||:|.::|||    ..
Mouse   237 VVLPESEDVLMDAVATKGPIATGIHVVSSSFRFYDGGVYYEPNCT-SSVNHAVLIIGYGYVGNET 300

  Fly   310 NGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYP 350
            :|.:||:||||:.:.||..|:|.|.::....|.|||...||
Mouse   301 DGNNYWLIKNSWGRRWGLSGYMMIAKDRNNHCAIASLAQYP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/58 (31%)
Peptidase_C1A 131..350 CDD:239068 85/223 (38%)
CtsqNP_083912.2 Inhibitor_I29 29..87 CDD:214853 18/57 (32%)
Peptidase_C1 125..342 CDD:278538 88/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.