DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and asic5

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_017951381.2 Gene:asic5 / 100498195 XenbaseID:XB-GENE-983430 Length:852 Species:Xenopus tropicalis


Alignment Length:327 Identity:98/327 - (29%)
Similarity:154/327 - (47%) Gaps:46/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDDFLRQTGKVYSDEERVYRE--SIFAAKMSLITLSNKNADNGV-------SGFRLGVNTLADMT 93
            |.||:::.|:.|.|..:|::|  .||     |.:...:|..|.:       |....|:|..:|::
 Frog    66 FLDFIQKYGRGYKDGSQVFQERYQIF-----LKSTERQNYLNAIALPTNLTSAAHYGINQFSDLS 125

  Fly    94 RKE-IATLLGSKISEFGERYTNGHINFVTARNPASAN-----LPEMFDWREKGGVTPPGFQGVGC 152
            .:| ..|.|.|        :..|:   .|:..|...:     ||..||||:|..|||...| :.|
 Frog   126 AEEFFYTYLRS--------FPTGN---YTSNKPFKNSAQQYFLPLRFDWRDKKLVTPVKNQ-LSC 178

  Fly   153 GACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTL--A 215
            ||||:|:..||:|.....:...|..||.|.::||:  |.:.||:||......:::......|  |
 Frog   179 GACWAFSVVGAVESAYAIKWHTLEELSVQQVIDCS--YLDSGCNGGSTNGALKWLYQTKTKLVRA 241

  Fly   216 NKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATIT-PGDEEKMKEVIATLGPLACSMNADTISF 279
            ::|.:......|..     .|..:..|.|..|.|.. .|.|:.|.:::..|||:...:||  :|:
 Frog   242 SEYNFKAKTGLCHY-----FPKTDFGVSINGYETQDFSGTEDAMMKMLVDLGPMVVIVNA--VSW 299

  Fly   280 EQYSGGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIA 344
            :.|.|||.: ..|:.|..||:|.|:||.......|||:|||:...||..|::.| :.....||..
 Frog   300 QDYLGGIIQ-HHCSSGAPNHAVLVIGYDKTGDTPYWIVKNSWGTAWGADGYVYI-KMGENICGYW 362

  Fly   345 SE 346
            |:
 Frog   363 SK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 18/68 (26%)
Peptidase_C1A 131..350 CDD:239068 73/219 (33%)
asic5XP_017951381.2 Inhibitor_I29 66..129 CDD:400519 17/67 (25%)
Peptidase_C1A 158..360 CDD:239068 70/213 (33%)
ASC 387..816 CDD:395688
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.