DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and LOC100498084

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_031747492.1 Gene:LOC100498084 / 100498084 -ID:- Length:335 Species:Xenopus tropicalis


Alignment Length:307 Identity:113/307 - (36%)
Similarity:172/307 - (56%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KVYSD-EERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEI-ATLLGSKISEFG 109
            |.|.| ||...|.:|:...:..|::.|.....|:..:.:|:|.|.|||.:|: ||:.|...|  |
 Frog    39 KSYKDGEEERARRTIWEETLKFISVHNLEYSLGLHTYEVGMNHLGDMTGEEVAATMTGYTGS--G 101

  Fly   110 ERYTN-GHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTG 173
            :...| .|:    .:....|..|...|||.:..|||...||..|.:|::|:..||||....::|.
 Frog   102 DSLANMSHV----PKEILEALAPPSIDWRTQNCVTPVRDQGSSCRSCYAFSAVGALECQWKKKTV 162

  Fly   174 VLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPR 238
            .|.:.|.|.||||:|..||.||:||..|..|:|::.:||...:.||||..:..||:.:    |..
 Frog   163 RLVTFSPQELVDCSDGEGNHGCNGGKIEKAFKYMKKYGVMEESAYPYTGQKGLCRKKQ----PGN 223

  Fly   239 ESLVK-IRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVT 302
            ..:|| |.|   :..|:|..:...:.|:||::.|:||.:..|.|:..|:|.:.:|...::||:|.
 Frog   224 IGVVKAIHD---LPSGNETLLMNTVGTIGPVSVSINASSEKFHQFKSGVYYNPDCLPNKVNHAVL 285

  Fly   303 VVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSY 349
            |||||.|||.|||::|||:...:||.|::::.||.|..||||:...|
 Frog   286 VVGYGKENGMDYWLVKNSWGVQFGENGYIKMARNRGNNCGIATRPVY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 16/50 (32%)
Peptidase_C1A 131..350 CDD:239068 88/220 (40%)
LOC100498084XP_031747492.1 Inhibitor_I29 30..89 CDD:214853 16/49 (33%)
Peptidase_C1A 120..333 CDD:239068 88/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.