DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and LOC100496172

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002938925.2 Gene:LOC100496172 / 100496172 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:327 Identity:105/327 - (32%)
Similarity:162/327 - (49%) Gaps:37/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QNFDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIAT 99
            |.::.:..:.||.| |.|...:|..|:......:...|:.||.|:..:||.:|..||.|.::   
 Frog    25 QEWNAWKSKYGKTYISHEREFFRRKIWEDSWEKVQKHNQLADQGLKKYRLEMNQFADKTAQD--- 86

  Fly   100 LLGSKISEFGERYTNGHINFVTA------RNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSF 158
                .:|....|.|.....|.:|      ||   ..||:..|||:...|||...||..||:||:|
 Frog    87 ----HVSRPCFRSTPKSGRFASAPVYSYDRN---TELPKEADWRKSKCVTPVRNQGELCGSCWAF 144

  Fly   159 ATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTLANKYPYTQT 223
            |....||.....:...:...|:|..|||  |..|.||.||:....||::.::|:.....|.|||.
 Frog   145 AAISVLESRYCIKKNKVIYFSEQQFVDC--DEKNDGCCGGWPIDAFEHVAENGIMRRKDYEYTQQ 207

  Fly   224 EMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYE 288
            :.:|..|..     :..::.:..:.|:.  :|:.|...:|..||:..::.... ..:.|..||: 
 Frog   208 KNECGYNSN-----KAVMLNVTKFYTLP--EEQNMAMSVALEGPITVAIGVSE-ELQMYEKGIF- 263

  Fly   289 DEECNQGELNHSVTVVGYGT-------ENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASE 346
            |.||.: |:||:||:|||||       |...||||||||:.:||||.|::|:.||:.. |.||::
 Frog   264 DGECAE-EVNHAVTIVGYGTKAAENEDEEDEDYWIIKNSWGKNWGENGYIRMKRNSNQ-CDIATK 326

  Fly   347 CS 348
            .:
 Frog   327 AA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 17/59 (29%)
Peptidase_C1A 131..350 CDD:239068 79/225 (35%)
LOC100496172XP_002938925.2 Inhibitor_I29 27..83 CDD:214853 16/55 (29%)
Peptidase_C1A 117..330 CDD:239068 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.