DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and XB986811

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_017952034.1 Gene:XB986811 / 100490139 XenbaseID:XB-GENE-986812 Length:331 Species:Xenopus tropicalis


Alignment Length:310 Identity:109/310 - (35%)
Similarity:173/310 - (55%) Gaps:19/310 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KVYSDE-ERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLL-GSKISEFG 109
            |.|.:: ..:.|..|:...:::|...|.....|:..:.||:|...|||.:|:..:: |.|:    
 Frog    37 KHYDNKIHELMRRLIWEKNLNIIRSHNLEFTQGLHTYELGMNKFGDMTSEEVVRMMTGLKV---- 97

  Fly   110 ERYTN-GHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTG 173
              :|. |..|..:..:.||..:|...|:|:||.|||...|| .||:||:|:|.|||||.|.::||
 Frog    98 --HTGMGPTNLTSDEDEASQRIPNSIDYRKKGYVTPIRDQG-ECGSCWAFSTVGALEGQLMKKTG 159

  Fly   174 VLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPP 237
            .|..:|.||||||..|  |.||.||:....|:|: ::.|:.....|||...:.:|:.| .:||  
 Frog   160 KLVGISPQNLVDCVKD--NFGCGGGYMTTAFKYVKKNKGIDSEEAYPYVGMDQKCKYN-VSGR-- 219

  Fly   238 RESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVT 302
               ..:|:.:..:..|.|..:|:.:..:||::..::|...:|..|..|||.|:.|:...:||:|.
 Frog   220 ---AAEIKGFKEVKKGSETALKKAVGLVGPISVGIDAGLDTFFLYKKGIYYDKSCDGDSINHAVL 281

  Fly   303 VVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPIL 352
            .||||.:....|||||||:.::||..|::.:.|..|..||||:..|||::
 Frog   282 AVGYGKQKKGKYWIIKNSWGEDWGNKGYILMAREKGNACGIANLASYPVM 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 13/50 (26%)
Peptidase_C1A 131..350 CDD:239068 86/219 (39%)
XB986811XP_017952034.1 Inhibitor_I29 28..87 CDD:214853 13/49 (27%)
Peptidase_C1 117..329 CDD:365882 86/220 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.