DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and LOC100364523

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001316813.1 Gene:LOC100364523 / 100364523 RGDID:2320837 Length:343 Species:Rattus norvegicus


Alignment Length:351 Identity:116/351 - (33%)
Similarity:181/351 - (51%) Gaps:35/351 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGF 82
            :|.||  ...:|....||| :.::..:..|:||.||.:.:..::...:..|.|.|:....|.:.:
  Rat    12 VGVVS--GASAFDLSLDVQ-WQEWKMKYEKLYSPEEELLKRVVWEENVKKIELHNRENSLGKNTY 73

  Fly    83 RLGVNTLADMTRKE-------IATLLGSKISEFGERYTNGHINFVTARNPAS----ANLPEMFDW 136
            .:.:|..||:|.:|       |...:.:.:....:|.....:       |.|    ..||:..||
  Rat    74 IMEINDFADLTDEEFKDMITGITLPINNTMKSLWKRALGSSL-------PNSWYWRDALPKFVDW 131

  Fly   137 REKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQE 201
            |::|.||....|| .|.:||:|...||:||.:|::||.|..||.||||||:...||.||.||...
  Rat   132 RKEGYVTHVRVQG-RCNSCWAFPVVGAIEGQMFKKTGKLTPLSVQNLVDCSKPQGNKGCRGGTTY 195

  Fly   202 YGFEYI-RDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATL 265
            ..|:|: ::.|:.....|||...|..||.|      |..|..||..:..: |.:|:.:.:.:||.
  Rat   196 NAFQYVLQNGGLESEATYPYEGKEGLCRYN------PNNSSAKITRFVAL-PENEDVLMDAVATK 253

  Fly   266 GPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNWG 326
            ||:|..::....|...|..|||.:.:|| ..:||:|.|||||.|    :|.:||:|:||:.:.||
  Rat   254 GPVAAGIHVVHSSLRFYKKGIYHEPKCN-NYVNHAVLVVGYGFEGNETDGNNYWLIQNSWGERWG 317

  Fly   327 EGGFMRILRNAGGFCGIASECSYPIL 352
            ..|:|:|.::....||||:...|||:
  Rat   318 LNGYMKIAKDRNNHCGIATFAQYPIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 14/65 (22%)
Peptidase_C1A 131..350 CDD:239068 87/223 (39%)
LOC100364523NP_001316813.1 Inhibitor_I29 29..87 CDD:214853 13/57 (23%)
Peptidase_C1A 126..341 CDD:239068 87/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.