powered by:
Protein Alignment CG6347 and LOC100332358
DIOPT Version :9
Sequence 1: | NP_610906.1 |
Gene: | CG6347 / 36531 |
FlyBaseID: | FBgn0033874 |
Length: | 352 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021333584.1 |
Gene: | LOC100332358 / 100332358 |
-ID: | - |
Length: | 258 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 35/66 - (53%) |
Gaps: | 6/66 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 FDDFLRQTGKVY-SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLL 101
|..|..:..:.| |::|...||::|......:..:|: .|:: :.:|:|..|| .:||:|.:.
Zfish 186 FSPFKEKFNRQYESEKEHEERENLFLHTFRFVHSNNR---AGLT-YSVGINHFAD-KKKELARMT 245
Fly 102 G 102
|
Zfish 246 G 246
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275401at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.