DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6347 and ctsz

DIOPT Version :9

Sequence 1:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001106427.1 Gene:ctsz / 100127597 XenbaseID:XB-GENE-959211 Length:296 Species:Xenopus tropicalis


Alignment Length:253 Identity:83/253 - (32%)
Similarity:134/253 - (52%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 ANLPEMFDWREKGG---VTPPGFQGVG--CGACWSFATTGALEGHL-FRRTGVLAS--LSQQNLV 184
            :.||:::|||...|   |:....|.:.  ||:||:..:|.|:...: .:|.||..|  ||.|:::
 Frog    51 SELPKVWDWRNLNGTNYVSTTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGVWPSAYLSVQHVI 115

  Fly   185 DCADDYGNMG-CDGGFQEYGFEYIRDHGV--TLANKYPYTQTEM----QCRQNETAGR---PPRE 239
            |||    |.| |:||.....:||...||:  ...|.|.....:.    ||....|.|:   ....
 Frog   116 DCA----NAGSCEGGDHGGVWEYANSHGIPDETCNNYQARDQKCDKFNQCGTCVTFGKCFYLSNY 176

  Fly   240 SLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVV 304
            :|.|:.|:.::: |.|:.|.|:... ||::|.:.| |...:.|:||:|.:.: ....:||.|:|.
 Frog   177 TLWKVGDFGSVS-GREKMMAEIYKN-GPISCGIMA-TEKLDAYTGGLYAEYQ-PSAMINHIVSVA 237

  Fly   305 GYG-TENGRDYWIIKNSYSQNWGEGGFMRILRNA--GG-----FCGIASECSY--PIL 352
            |:| .|:|.:|||::||:.:.|||.|::||:.:|  ||     ...|..:|:|  |||
 Frog   238 GWGLDESGAEYWIVRNSWGEPWGERGWLRIVTSAYKGGKGADYNLAIEEDCAYGDPIL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458
Peptidase_C1A 131..350 CDD:239068 79/246 (32%)
ctszNP_001106427.1 Peptidase_C1A_CathepsinX 53..294 CDD:239149 80/248 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.