DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and AT1G03720

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_171868.1 Gene:AT1G03720 / 839426 AraportID:AT1G03720 Length:274 Species:Arabidopsis thaliana


Alignment Length:282 Identity:53/282 - (18%)
Similarity:92/282 - (32%) Gaps:103/282 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PKAVNTVTSAASDPPASQAASASFDIITDFGLTVAVEDQGV-------NCSS-----SWAYATAK 145
            ||..|.:...|:      .|......||....|   :|.||       ||:|     .||.|..:
plant    26 PKVPNEIKREAA------TAKKKGPTITPVTQT---DDNGVRSKLCYLNCNSYKIEICWAIALTR 81

  Fly   146 AVEIM-NAVQ----------------------TANPLPSSLSAQQLLDCAGMGTGCSTQTPLAAL 187
            .:::: |..|                      |....|.|:..:.|.|               |:
plant    82 LLQVIYNITQEYIAGRLRFDHDDLVVHLKMKKTRGKRPGSMKLKNLKD---------------AI 131

  Fly   188 NYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYST-----------------VA 235
            |::.                    ..|:.:...|.|......|:.|                 ..
plant   132 NHIA--------------------VKGLLKKRESKSKAGSDIGHHTKWNFSMEKCPSKDFIKSKV 176

  Fly   236 DNDDAAVMRYVSNGFPVIVEYNPATFGFMQYS-SGVYVQETRALTNPKSSQFLVVVGYDHDVDSN 299
            |....|:...:::.|..|...:..:.|...|: |||.:::..|     ....:::|||.:..::.
plant   177 DISPVAIAFDITHNFQFIGNVSKKSNGLSIYNVSGVDMEDGDA-----GGHVVLIVGYGYTKENK 236

  Fly   300 LDYWRCLNSFGDTWGEEGYIRI 321
            | ::...||:|:.||.:|:.||
plant   237 L-FFLIQNSWGEDWGVKGFGRI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458
Peptidase_C1A 114..336 CDD:239068 48/261 (18%)
AT1G03720NP_171868.1 Peptidase_C1 57..261 CDD:239110 43/242 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.