DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and XBCP3

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_563855.1 Gene:XBCP3 / 837517 AraportID:AT1G09850 Length:437 Species:Arabidopsis thaliana


Alignment Length:320 Identity:86/320 - (26%)
Similarity:140/320 - (43%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFS 81
            |...||              |||.|...|......|..|.:.|.|||...:   .||..::|.|:
plant    35 WCQKHG--------------KTYGSEEERQQRIQIFKDNHDFVTQHNLITN---ATYSLSLNAFA 82

  Fly    82 DIRLIQFAALLPKAVNTVTSAASDPPASQAASASFDI-ITDF------GLTVAVEDQGVNCSSSW 139
            |:...:|.|   ..:....||.|...||:..|....: :.|.      |....|:||| :|.:.|
plant    83 DLTHHEFKA---SRLGLSVSAPSVIMASKGQSLGGSVKVPDSVDWRKKGAVTNVKDQG-SCGACW 143

  Fly   140 AYATAKAVEIMNAVQTANPLPSSLSAQQLLDC-AGMGTGCSTQTPLAALNYLTQLTDAYLYPEVD 203
            :::...|:|.:|.:.|.:.:  |||.|:|:|| .....||:......|..::  :.:..:..|.|
plant   144 SFSATGAMEGINQIVTGDLI--SLSEQELIDCDKSYNAGCNGGLMDYAFEFV--IKNHGIDTEKD 204

  Fly   204 YPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSS 268
            ||..   :..|.|:........|.:..|:.|..||:.|:|..|: ..||.|....:...|..|||
plant   205 YPYQ---ERDGTCKKDKLKQKVVTIDSYAGVKSNDEKALMEAVA-AQPVSVGICGSERAFQLYSS 265

  Fly   269 GVYVQETRALTNPKSSQF---LVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRS 325
            |::       :.|.|:..   :::|||..  .:.:|||...||:|.:||.:|::.:.|.:
plant   266 GIF-------SGPCSTSLDHAVLIVGYGS--QNGVDYWIVKNSWGKSWGMDGFMHMQRNT 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 16/59 (27%)
Peptidase_C1A 114..336 CDD:239068 59/223 (26%)
XBCP3NP_563855.1 Inhibitor_I29 32..89 CDD:285458 19/70 (27%)
Peptidase_C1 118..333 CDD:278538 59/217 (27%)
GRAN 351..407 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.