DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and AT4G11310

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_567376.1 Gene:AT4G11310 / 826733 AraportID:AT4G11310 Length:364 Species:Arabidopsis thaliana


Alignment Length:346 Identity:95/346 - (27%)
Similarity:145/346 - (41%) Gaps:64/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFA------NYYFIYNRNQVAQHNAQADRNRT 71
            |...|...||              |.|.|.:.:...      |..||.|||          ....
plant    48 IFESWMVKHG--------------KVYGSVAEKERRLTIFEDNLRFINNRN----------AENL 88

  Fly    72 TYREAVNQFSDIRLIQFAALL-------PKAVNTVTSAASD---PPASQAASASFDIITDFGLTV 126
            :||..:..|:|:.|.::..:.       |:  |.|...:||   ..|......|.|...: |...
plant    89 SYRLGLTGFADLSLHEYKEVCHGADPRPPR--NHVFMTSSDRYKTSADDVLPKSVDWRNE-GAVT 150

  Fly   127 AVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTPLAALNYLT 191
            .|:||| :|.|.||::|..|||.:|.:.|...:  :||.|.|::|.....||.......|..:: 
plant   151 EVKDQG-HCRSCWAFSTVGAVEGLNKIVTGELV--TLSEQDLINCNKENNGCGGGKLETAYEFI- 211

  Fly   192 QLTDAYLYPEVDYPNNNSLKTPGMCQPP-SSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVE 255
             :.:..|..:.|||..   ...|:|... ...:..|.:.||..:..||::|:|:.|::. ||...
plant   212 -MKNGGLGTDNDYPYK---AVNGVCDGRLKENNKNVMIDGYENLPANDESALMKAVAHQ-PVTAV 271

  Fly   256 YNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIR 320
            .:.::..|..|.|||:  :....||  .:..:|||||  ..::..|||...||.|.||||.||::
plant   272 IDSSSREFQLYESGVF--DGSCGTN--LNHGVVVVGY--GTENGRDYWLVKNSRGITWGEAGYMK 330

  Fly   321 IVRRSNQP-----IAKNAVFP 336
            :.|....|     ||..|.:|
plant   331 MARNIANPRGLCGIAMRASYP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 14/65 (22%)
Peptidase_C1A 114..336 CDD:239068 70/227 (31%)
AT4G11310NP_567376.1 Inhibitor_I29 49..104 CDD:214853 17/78 (22%)
Peptidase_C1 137..352 CDD:395062 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.