DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and AT3G19400

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566634.2 Gene:AT3G19400 / 821474 AraportID:AT3G19400 Length:362 Species:Arabidopsis thaliana


Alignment Length:371 Identity:100/371 - (26%)
Similarity:156/371 - (42%) Gaps:65/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLCCLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANY-----------YFIYNRN 57
            ::|..|||:...|.|..     .:.:..|......|......|..||           .|..|..
plant    14 VILSVLLLSSSLGVATE-----TEIERNETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNLK 73

  Fly    58 QVAQHNAQADRNRTTYREAVNQFSDIRLIQFAA--LLPKAVNTVTSAASDPPASQAASASFDIIT 120
            .|.:||:..||   |:...:.:|:|:...:|.|  |..|...|..|..::    :......|::.
plant    74 FVDEHNSVPDR---TFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKTE----RYLYKEGDVLP 131

  Fly   121 D------FGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDC--AGMGTG 177
            |      .|..|:|:||| ||.|.||::...|||.:|.:.|...:  |||.|:|:||  ..:..|
plant   132 DEVDWRANGAVVSVKDQG-NCGSCWAFSAVGAVEGINQITTGELI--SLSEQELVDCDRGFVNAG 193

  Fly   178 CSTQTPLAALNYLTQ--LTDAYLYPEVDYP-NNNSLKTPGMCQPPSSVSVG-VKLAGYSTVADND 238
            |..    ..:||..:  :.:..:..:.||| |.|.|   |:|....:.:.. |.:.||..|..:|
plant   194 CDG----GIMNYAFEFIMKNGGIETDQDYPYNANDL---GLCNADKNNNTRVVTIDGYEDVPRDD 251

  Fly   239 DAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGYDHDVDSNLDYW 303
            :.::.:.|::. ||.|....::..|..|.|||..    ..........:|||||..  .|..|||
plant   252 EKSLKKAVAHQ-PVSVAIEASSQAFQLYKSGVMT----GTCGISLDHGVVVVGYGS--TSGEDYW 309

  Fly   304 RCLNSFGDTWGEEGYIRIVRRSNQPIAKNAV-----------FPSA 338
            ...||:|..||:.||:::.|..:.|..|..:           |||:
plant   310 IIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYPTKSSFPSS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 15/70 (21%)
Peptidase_C1A 114..336 CDD:239068 70/244 (29%)
AT3G19400NP_566634.2 Inhibitor_I29 44..100 CDD:214853 14/58 (24%)
Peptidase_C1 130..348 CDD:395062 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.