DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsz

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_071720.1 Gene:Ctsz / 64138 MGIID:1891190 Length:306 Species:Mus musculus


Alignment Length:282 Identity:62/282 - (21%)
Similarity:109/282 - (38%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AQADRNRTTYREAVNQFSDIRLIQFAAL----LPKAVNTVTSAASDPPASQAASASFDIITDFGL 124
            |.|.|.|..:|.....:..||..|.|.|    .|:....::      ||....:..:..:.....
Mouse    20 ASAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLS------PADLPKNWDWRNVNGVNY 78

  Fly   125 TVAVEDQGV--NCSSSWAYATAKAVEIMNAVQTANPLPS-SLSAQQLLDCAGMGTGCSTQTPLAA 186
            .....:|.:  .|.|.||:.:..|:.....::.....|| .||.|.::||...|: |.....|..
Mouse    79 ASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSILLSVQNVIDCGNAGS-CEGGNDLPV 142

  Fly   187 LNYL------TQLTDAYLYPEVDYPNNNSLKTP---GMCQPPSSVSVGVKLAGYSTVADNDDAAV 242
            ..|.      .:..:.|...:.|....|...|.   ..|....:.::. ::..|.:::..:....
Mouse   143 WEYAHKHGIPDETCNNYQAKDQDCDKFNQCGTCTEFKECHTIQNYTLW-RVGDYGSLSGREKMMA 206

  Fly   243 MRYVSNGFPVIVEYNPATFGFM------QYSSGVYVQ-ETRALTNPKSSQFLVVVGYDHDVDSNL 300
            ..| :||        |.:.|.|      .|:.|:|.: :.:|:.|    ..:.|.|:....| .:
Mouse   207 EIY-ANG--------PISCGIMATEMMSNYTGGIYAEHQDQAVIN----HIISVAGWGVSND-GI 257

  Fly   301 DYWRCLNSFGDTWGEEGYIRIV 322
            :||...||:|:.|||:|::|||
Mouse   258 EYWIVRNSWGEPWGEKGWMRIV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 7/23 (30%)
Peptidase_C1A 114..336 CDD:239068 49/228 (21%)
CtszNP_071720.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 49/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.