DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and ctsf

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001071036.1 Gene:ctsf / 565588 ZFINID:ZDB-GENE-030131-9831 Length:473 Species:Danio rerio


Alignment Length:313 Identity:80/313 - (25%)
Similarity:131/313 - (41%) Gaps:38/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVDFQTYEDNFNKTYASTSARNFANYYFIYNRN-QVAQHNAQADRNRTTYREAVNQFSDIRLIQF 88
            |..|:.:...:|:||:|.....  ....|:.:| :.||.....::....|  .:.:|||:...:|
Zfish   172 LTMFKNFMITYNRTYSSQEEAE--KRLRIFQQNMKTAQTLQSLEQGSAEY--GITKFSDLTEDEF 232

  Fly    89 AALLPKAVNTVTSAAS-----DP--PASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKA 146
            ..:.   :|.:.|..|     .|  |||..|..::| ..|.|....|::||: |.|.||::....
Zfish   233 RMMY---LNPMLSQWSLKKEMKPAIPASAPAPDTWD-WRDHGAVSPVKNQGM-CGSCWAFSVTGN 292

  Fly   147 VEIMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLK 211
            :|.....:|...|  |||.|:|:||..:...|....|..|...:..|  ..|..|.||......:
Zfish   293 IEGQWFKKTGQLL--SLSEQELVDCDKLDQACGGGLPSNAYEAIENL--GGLETETDYSYTGHKQ 353

  Fly   212 TPGMCQPPSSVSVGVKLAGY---STVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQ 273
            :   |    ..|.| |:|.|   |.....|:..:..:::...||....|  .|....|..|| ..
Zfish   354 S---C----DFSTG-KVAAYINSSVELPKDEKEIAAFLAENGPVSAALN--AFAMQFYRKGV-SH 407

  Fly   274 ETRALTNP-KSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRS 325
            ..:...|| .....:::||:..  .:.:.:|...||:|:.:||:||..:.|.|
Zfish   408 PLKIFCNPWMIDHAVLLVGFGQ--RNGVPFWAIKNSWGEDYGEQGYYYLYRGS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 13/60 (22%)
Peptidase_C1A 114..336 CDD:239068 57/216 (26%)
ctsfNP_001071036.1 CY 34..144 CDD:214484
PTZ00203 143..472 CDD:185513 80/313 (26%)
Inhibitor_I29 175..231 CDD:214853 13/59 (22%)
Peptidase_C1 262..471 CDD:278538 57/216 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.