DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and MGC174155

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001096588.1 Gene:MGC174155 / 564906 -ID:- Length:335 Species:Danio rerio


Alignment Length:357 Identity:93/357 - (26%)
Similarity:158/357 - (44%) Gaps:46/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLLLCCLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYY--------FIYNRN 57
            ||.||   :.|.|.:.:|.:.    :|.| .:|::|    |..:::..:|:        .|:..|
Zfish     2 MFALL---VTLCISAVFAASS----IDIQ-LDDHWN----SWKSQHGKSYHEDVEVGRRMIWEEN 54

  Fly    58 --QVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDP----PASQAASASF 116
              ::.|||.:......|::..:|||.|:...:|...:....:.....:..|    |:..||....
Zfish    55 LRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEEFRQAMNGYKHDPNRTSQGPLFMEPSFFAAPQQV 119

  Fly   117 DIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM--GTGCS 179
            | ....|....|:|| ..|.|.|::::..|:|.....:|...:  |:|.|.|:||:..  ..||:
Zfish   120 D-WRQRGYVTPVKDQ-KQCGSCWSFSSTGALEGQLFRKTGKLI--SMSEQNLVDCSRPQGNQGCN 180

  Fly   180 TQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMR 244
            ......|..|:.:  :..|..|..||.......|....|..:|:   |:.|:..:...::.|:|.
Zfish   181 GGIMDQAFQYVKE--NKGLDSEQSYPYLARDDLPCRYDPRFNVA---KITGFVDIPRGNELALMN 240

  Fly   245 YVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGYDH---DVDSNLDYWRCL 306
            .|:...||.|..:.:......|.||:|.:  ||.|: :....::||||.:   ||..| .||...
Zfish   241 AVAAVGPVSVAIDASHQSLQFYQSGIYYE--RACTS-RLDHAVLVVGYGYQGADVAGN-RYWIVK 301

  Fly   307 NSFGDTWGEEGYIRIVRRSNQ--PIAKNAVFP 336
            ||:.|.||::|||.:.:..|.  .||..|.:|
Zfish   302 NSWSDKWGDKGYIYMAKDKNNHCGIATMASYP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 15/69 (22%)
Peptidase_C1A 114..336 CDD:239068 64/228 (28%)
MGC174155NP_001096588.1 Inhibitor_I29 28..86 CDD:214853 13/61 (21%)
Peptidase_C1 115..334 CDD:278538 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.