DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Cts7

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001346316.1 Gene:Cts7 / 56092 MGIID:1860262 Length:331 Species:Mus musculus


Alignment Length:281 Identity:77/281 - (27%)
Similarity:123/281 - (43%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VNQFSDIRLIQFAALLPKAVNTVTSAASDPPAS----QAASASFDIITDF---GLTVAVEDQGVN 134
            :|.|: |.:.:|..:..:.:..:|.::|.|..:    |..:.......|:   |....|..|| :
Mouse    70 MNNFT-IEMNEFGDMTGEE
MKMLTESSSYPLRNGKHIQKRNPKIPPTLDWRKEGYVTPVRRQG-S 132

  Fly   135 CSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCA-GMGT-GCSTQTPLAALNYLTQLTDAY 197
            |.:.||::....:|.....:|...:|  ||.|.|:||: ..|| ||....|..|..|:.  .:..
Mouse   133 CGACWAFSVTACIEGQLFKKTGKLIP--LSVQNLMDCSVSYGTKGCDGGRPYDAFQYVK--NNGG 193

  Fly   198 LYPEVDYPNNNSLKTPGMC--QPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPAT 260
            |..|..||.....|   .|  :|..||   ||:..:..|..|::|.:...|::| |:.|..:.:.
Mouse   194 LEAEATYPYEAKAK---HCRYRPERSV---VKVNRFFVVPRNEEALLQALVTHG-PIAVAIDGSH 251

  Fly   261 FGFMQYSSGVYVQETRALTNPKSSQ-------FLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGY 318
            ..|..|..|:|.:       ||..:       .||..||:.....|..||...||.|:.|||.||
Mouse   252 ASFHSYRGGIYHE-------PKCRKDTLDHGLLLVGYGYEGHESENRKYWLLKNSHGERWGENGY 309

  Fly   319 IRIVRRSNQ--PIAKNAVFPS 337
            :::.|..|.  .||..|::|:
Mouse   310 MKLPRGQNNYCGIASYAMYPA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 3/10 (30%)
Peptidase_C1A 114..336 CDD:239068 68/237 (29%)
Cts7NP_001346316.1 Inhibitor_I29 29..87 CDD:214853 4/17 (24%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18776147 33..50
Peptidase_C1A 113..329 CDD:239068 68/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.