DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctla2a

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006253587.1 Gene:Ctla2a / 498690 RGDID:1565540 Length:188 Species:Rattus norvegicus


Alignment Length:77 Identity:17/77 - (22%)
Similarity:36/77 - (46%) Gaps:12/77 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQADRNRTTYREA 76
            ::|:.|           :.::..|.|||:....|: ....:..::..:..|||...:.:|::...
  Rat    11 SLDTEW-----------EEWKKKFGKTYSPDEERH-RRAVWEESKKTIEAHNADYKQGKTSFYMG 63

  Fly    77 VNQFSDIRLIQF 88
            :|||||:...:|
  Rat    64 LNQFSDLTTEEF 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 14/59 (24%)
Peptidase_C1A 114..336 CDD:239068
Ctla2aXP_006253587.1 Inhibitor_I29 16..74 CDD:214853 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.