DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and ctsc

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_999887.1 Gene:ctsc / 368704 ZFINID:ZDB-GENE-030619-9 Length:455 Species:Danio rerio


Alignment Length:255 Identity:70/255 - (27%)
Similarity:104/255 - (40%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 AALLPKAVNTVTSAASDPPASQAASA-----SFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVE 148
            |:.:|:.|..||.||.    |:|||.     .:..:........|.:| ..|.|.:::||...:|
Zfish   202 ASRIPRRVRPVTVAAD----SKAASGLPQHWDWRNVNGVNFVSPVRNQ-AQCGSCYSFATMGMLE 261

  Fly   149 IMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTPLAALNYLTQL----TDAYLYPEVDYPNNNS 209
            ....:||.|......|.||::.|:....||....|.....|:...    .|.:.|...|.|.|  
Zfish   262 ARVRIQTNNTQQPVFSPQQVVSCSQYSQGCDGGFPYLIGKYIQDFGIVEEDCFPYTGSDSPCN-- 324

  Fly   210 LKTPGMCQPPSSVS---VGVKLAGYSTVADNDDAAVMRYVSNG-FPVIVEYNPATFGFMQYSSGV 270
              .|..|....:..   ||....|.|     :.|.::..|.|| ..|.:|..|   .||.|..|:
Zfish   325 --LPAKCTKYYASDYHYVGGFYGGCS-----ESAMMLELVKNGPMGVALEVYP---DFMNYKEGI 379

  Fly   271 YVQE-TRALTNP--KSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ 327
            |... .|...||  .::..:::|||.....:...||...||:|..|||.|:.||.|.:::
Zfish   380 YHHTGLRDANNPFELTNHAVLLVGYGQCHKTGEKYWIVKNSWGSGWGENGFFRIRRGTDE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458
Peptidase_C1A 114..336 CDD:239068 59/230 (26%)
ctscNP_999887.1 CathepsinC_exc 20..132 CDD:285926
Peptidase_C1A_CathepsinC 224..452 CDD:239112 59/229 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.