DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and CG6357

DIOPT Version :10

Sequence 1:NP_610905.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster


Alignment Length:143 Identity:33/143 - (23%)
Similarity:51/143 - (35%) Gaps:39/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVDFQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQF- 88
            ||||..:.||   .|.....|:.    |..|..:|..||.:.|....::::.:||:||:...:: 
  Fly    76 LVDFDVHYDN---DYERQKRRDI----FCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTFEEWK 133

  Fly    89 AALLPKAVNTVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSW---------AYATA 144
            ....||.:..:.|.:|..                      |...|||.::|         .|..|
  Fly   134 EKQTPKVMPEIASESSKE----------------------ERDKVNCQAAWEKFLIDFGAQYKNA 176

  Fly   145 KAVEIMNAVQTAN 157
            ...|....|..||
  Fly   177 NETEKRRNVFCAN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_610905.1 Inhibitor_I29 28..82 CDD:214853 13/53 (25%)
Peptidase_C1A 114..336 CDD:239068 11/53 (21%)
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 18/62 (29%)
Inhibitor_I29 162..221 CDD:214853 7/28 (25%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.