DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsf

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001029282.1 Gene:Ctsf / 361704 RGDID:1308181 Length:462 Species:Rattus norvegicus


Alignment Length:348 Identity:87/348 - (25%)
Similarity:132/348 - (37%) Gaps:93/348 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FQTYEDNFNKTYASTSARNFANYYF-IYNRNQVAQHNAQA-DRNRTTYREAVNQFSDIRLIQFAA 90
            |:.:...:|:||.|   |..|.:.. ::.||.:.....|| ||....|  .:.:|||:...:|..
  Rat   165 FKDFMTTYNRTYES---REEAQWRLTVFARNMIRAQKIQALDRGTAQY--GITKFSDLTEEEFHT 224

  Fly    91 LLPKAVNTVTSAASDPPASQAASASFDIITDF----------GLTVAVEDQGVNCSSSWAYATAK 145
            :.   :|.:....|....|.|.|     |.|.          |....|:|||: |.|.||::...
  Rat   225 IY---LNPLLQKESGGKMSLAKS-----INDLAPPEWDWRKKGAVTEVKDQGM-CGSCWAFSVTG 280

  Fly   146 AVEIMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTP------------------------LAA 186
            .||....:.....|  |||.|:||||..|...|....|                        :.|
  Rat   281 NVEGQWFLNRGTLL--SLSEQELLDCDKMDKACMGGLPSNAYTAIKNLGGLETEDDYGYQGHVQA 343

  Fly   187 LNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFP 251
            .|:.||:...|:        |:|::                       ...|:..:..:::...|
  Rat   344 CNFSTQMAKVYI--------NDSVE-----------------------LSRDENKIAAWLAQKGP 377

  Fly   252 VIVEYNPATFGFMQYSSGVYVQETRALTNP-KSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGE 315
            :.|..|  .||...|..|: ....|.|.:| .....:::|||.:  .||:.||...||:|..|||
  Rat   378 ISVAIN--AFGMQFYRHGI-AHPFRPLCSPWFIDHAVLLVGYGN--RSNIPYWAIKNSWGRDWGE 437

  Fly   316 EGYIRIVRRSN----QPIAKNAV 334
            |||..:.|.|.    ..:|.:||
  Rat   438 EGYYYLYRGSGACGVNTMASSAV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 17/61 (28%)
Peptidase_C1A 114..336 CDD:239068 64/260 (25%)
CtsfNP_001029282.1 Inhibitor_I29 165..221 CDD:214853 17/60 (28%)
Peptidase_C1 249..460 CDD:395062 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.