DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and CtsB1

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:234 Identity:53/234 - (22%)
Similarity:83/234 - (35%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 VEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCA-GMGTGCSTQTPLAALNYLT 191
            :.||| :|.|.||:...:|:.....:.:...:....||..|:.|. ..|.||:...|.||.:|.|
  Fly   106 IRDQG-SCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGFPGAAWSYWT 169

  Fly   192 QLTDAYLYPEVDYPNNNSLKTPGMCQP--------------PSSVSVG-------VKLAGYSTVA 235
            :.......|   |.:|..      |:|              |.....|       |..:||:.  
  Fly   170 RKGIVSGGP---YGSNQG------CRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTV-- 223

  Fly   236 DNDDAAVMRYVSNGFPV----------IVEYNPATFGF------MQYSSGVYVQETRALTNPKSS 284
              |.|....:.|..:.|          |:...|....|      :.|..|||..|.   ......
  Fly   224 --DYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEH---GKELGG 283

  Fly   285 QFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVR 323
            ..:.::|:....:..:.||...||:...||:.|:.||:|
  Fly   284 HAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458
Peptidase_C1A 114..336 CDD:239068 53/234 (23%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 53/234 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.